SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013718 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013718
Domain Number 1 Region: 127-368
Classification Level Classification E-value
Superfamily vWA-like 2.18e-70
Family Integrin A (or I) domain 0.00000299
Further Details:      
 
Domain Number 2 Region: 1128-1312
Classification Level Classification E-value
Superfamily Fibronectin type III 4.68e-35
Family Fibronectin type III 0.00000414
Further Details:      
 
Domain Number 3 Region: 1507-1708
Classification Level Classification E-value
Superfamily Fibronectin type III 8.78e-35
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 4 Region: 991-1109
Classification Level Classification E-value
Superfamily CalX-like 2.22e-20
Family CalX-beta domain 0.00073
Further Details:      
 
Domain Number 5 Region: 626-709
Classification Level Classification E-value
Superfamily Integrin beta tail domain 1.96e-16
Family Integrin beta tail domain 0.0041
Further Details:      
 
Domain Number 6 Region: 29-77
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000235
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 7 Region: 539-577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000126
Family Integrin beta EGF-like domains 0.02
Further Details:      
 
Domain Number 8 Region: 581-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000893
Family Integrin beta EGF-like domains 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000013718
Domain Number - Region: 510-540
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0053
Family Integrin beta EGF-like domains 0.043
Further Details:      
 
Domain Number - Region: 469-495
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family Integrin beta EGF-like domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013718   Gene: ENSMPUG00000013821   Transcript: ENSMPUT00000013935
Sequence length 1803
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896922.1:5410331:5437338:-1 gene:ENSMPUG00000013821 transcript:ENSMPUT00000013935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGPRPSRWSRLLLLAVVLGASFPGEMANRCKRAQVKSCTECIRVDRECAYCTDEMFKER
RCNTQAELLAAGCRWESLVVMESSFEITEDTQINMNLQRSQVSPQGLRVRLRPGEEQHFE
MKVFEPEKSPMDLYILMDFSNSMSDDLDNLKQMGERLAQVLKTLTDDYTIGFGKFVDKVS
VPQTDMRPEKLKEPWPNSDPPFSFKNVISLTNNLDEFRNKLLGERISGNLDAPEGGFDAI
LQVAVCTRDIGWRPDSTHVLVFSTESAFHYEADGANVLAGILSRNDEACHLDSSGTYTQY
KMQDYPSVPTLVRLLGKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVDLL
QEAFQLIRSNLDIRALESPRGLRTEVTSAMFQKTDTGSFHITRGIPGTYQVQLRAMEAVD
GTHVCQLGEEDRKGTIHLKPSFSDGLWMDAGIICDVCPCELQKEELSARCNYHGDFMCGH
CVCSEGWSGKTCSCSTGSLSDIKPCLREGEDKPCSGRGECQCGHCICYGEGRYEGPFCEY
DNFQCPRASGVLCNDRGRCSMGQCACEPGWTGLSCDCPLSNATCIDSSGGICNGRGYCEC
GRCHCNQQSLYTDTICEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGRMCEECSFKVKMV
DELKTEEVVEHCSFRDEEDDCTYSYTVEGDGAPGPNSTVLVHKKKDCPPRSFWWLIPLLL
FLLPLLALLLLLCWKYCACCKACLALLPCCNRGHIVGFKEDHYMLRENLMASDHLDTPML
RSGNLKGRDMVRWKITNNVQRPGFASHTSSTNPTELVPYGLSLRLARLCTENLLKPDTRE
CNQLRQEVEENLNEVYRQITDSHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKQALL
KLTEKHVEQGSFHELKVAPGYYTITADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQ
LLVEAIDVPMGTATLGRRLVNITIIKEQASGVVSFEKAEYAVSGGDQVARIPVIRRILDN
GKSQVSYRTQDNTAQGNRDYIPAEGELLFQPGETWKELQVKLLELQEMDSLLRGRQTRRF
HIQLTNPKFGARLGQPHSATVTIGDPDELDRNFTSQTLASFPHHGDLGAPQNPNAKAAGS
RKIHFNWLPPPGKPAGYRVKYWIQGDPESEAHLLDSKVPSAELTNLYPYCDYEMKVCAYG
PQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLV
NEDNRPIGPMKKVLVDSPKKRTLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQP
KRPMSIPIIPDIPIVDAQCGEDYESFLMYSDDVLRSPAGSQRPSVSDDTEHLVNGRMDFA
FPGSANSLHRMTVANAAYGTHLSPHLPHRVLSTSSTLTRDYHSLTRTENSHSATLPRDYS
TLSSISSHSLPPIWEEGRSRLPLSWALGALSRAQMKGFPPSGDSRDTIILAGQPAAPIRP
DPRLAAGVPNTPTRLVFSALGPTSLKVSWQEPQCEQVLQGYSVEYQLLSGGELYHLNIPN
PSQTSVVVEDLLPNHSYVFRVRAQSQEGWGPEREGVITIESQVHPQSPLCPLPGSTFTLS
TPSAPGPLVFTALSPDSLQLSWERPRRPDGNILGYLVTCEMAHGGEPATTFLVDGDSPES
RLTVPGLSENVPYKFKVQAKTTEGYGPEREGIITIESQDGGPFPQLGSHAGLFQHSLPGE
YSSITTTHTSTTEPFLLDGLSLGTQRLEAGGSLTRHVTQEFVSRTLTTSGTLSTQVDQQF
FQT
Download sequence
Identical sequences M3YQV9
ENSMPUP00000013718 XP_012909870.1.14098 ENSMPUP00000013718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]