SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013729 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013729
Domain Number 1 Region: 24-112
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 3.01e-34
Family Ribosomal L11/L12e N-terminal domain 0.00000649
Further Details:      
 
Domain Number 2 Region: 101-176
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.88e-17
Family Ribosomal protein L11, C-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013729   Gene: ENSMPUG00000013832   Transcript: ENSMPUT00000013946
Sequence length 193
Comment pep:novel scaffold:MusPutFur1.0:GL896954.1:7041354:7044672:1 gene:ENSMPUG00000013832 transcript:ENSMPUT00000013946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SARRRQRCNSLRSSRIRVHPTPATSAMPPKFDPNEIKVVYLRCTGGEVGATSALAPKIGP
LGLSPKKVGDDIAKATGDWKGLRITVKLTIQNRQAQIEVVPSASALIIKALKEPPRDRKK
QKNSAVKHSGNITFDEIVNIARQMRHRSLARELSGTIKEILGTAQSVGCNVDGRHPHDII
DDINSGAVECPAV
Download sequence
Identical sequences M3YQX0
ENSMPUP00000013729 ENSMPUP00000013729

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]