SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013781 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013781
Domain Number 1 Region: 17-178
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.75e-35
Family Glyoxalase I (lactoylglutathione lyase) 0.0000000736
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013781   Gene: ENSMPUG00000013884   Transcript: ENSMPUT00000013998
Sequence length 184
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896902.1:9462508:9489842:1 gene:ENSMPUG00000013884 transcript:ENSMPUT00000013998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPQPASSGLTDEAALGCCSDPDPSTKDFLLQQTMLRIKDPKKSLDFYTRILGMTLLQK
LDFPTMKFSLYFLAYEEKNDIPKDKDEKIAWVFSRKATLELTHNWGTEDDETQSYHSGNS
DPRGFGHIGIAVPDVHGACKRFEELGVKFVKRPDDGKMKGLAFIQDPDGYWIEILNPNKM
TTII
Download sequence
Identical sequences M3YR22
ENSMPUP00000013781 XP_004740049.1.14098 ENSMPUP00000013781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]