SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000013823 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000013823
Domain Number 1 Region: 34-234
Classification Level Classification E-value
Superfamily Ribosomal protein S7 8.24e-51
Family Ribosomal protein S7 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000013823   Gene: ENSMPUG00000013928   Transcript: ENSMPUT00000014043
Sequence length 242
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896922.1:5813761:5817530:-1 gene:ENSMPUG00000013928 transcript:ENSMPUT00000014043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAPAGKVARGWSVLALTLRTAVPRLPGLTQVRWSRYSPEYRDPQTDKEYYRKPLAELTE
EEKCEQELRKTQLIKAAPAAKTSSVFEDPVISKFINMMMKGGNKVLARSLMTQTLEAVKR
KQFEKYHAASAEEQATIERNPYTIFHQALKNCEPVIGLVPILRGGHFYQVPVPLPARRRR
FLAMKWMLTECREKKHRRTLMPEKLSHELLEAFHNQGPVIKKKHDMHKMAEANRALAHYR
WW
Download sequence
Identical sequences M3YR64
ENSMPUP00000013823 ENSMPUP00000013823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]