SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014023 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014023
Domain Number 1 Region: 141-363
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.09e-56
Family C-terminal domain of adrenodoxin reductase-like 0.00000000461
Further Details:      
 
Domain Number 2 Region: 37-199
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 9.06e-17
Family N-terminal domain of adrenodoxin reductase-like 0.00000438
Further Details:      
 
Domain Number 3 Region: 366-491
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 0.000000706
Family N-terminal domain of adrenodoxin reductase-like 0.00000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014023   Gene: ENSMPUG00000014131   Transcript: ENSMPUT00000014246
Sequence length 492
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896922.1:6137768:6149413:1 gene:ENSMPUG00000014131 transcript:ENSMPUT00000014246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPRCWRWWHWSAWRRTRPPPAGSTPSVWQQFSTQEQGPQICVVGSGPAGFYTTQHLLKH
HPRAHVDIYEKQLVPFGLVRFGVAPDHPEVKNVINTFTQTARSDRCAFRGNVVVGRDVAV
SELQAAYHAVVLSYGAEDHQALEIPGEELPGVFSARAFVGWYNGLPENRELAPDLSCDTA
VILGQGNVALDVARILLTPPGHLEKTDITEAALGVLRQSRVKTVWIVGRRGPLQVAFTIK
ELREMIQLPGTRPMLDPADFLGLQDRIKELPRQRKRLTELLLRTATEKPGAEEAARQASA
ARTWGLRFFRSPQQVLPSPNGRRVAGIRLAVTRLEGVGEAARAAPTGDTEDLPCGLVLSS
VGYKSRPIDPNVPFDPKLGVIPNMEGRVLGVPGLYCSGWVKRGPTGVIATTMTDSFLTGQ
MLLQDLKAGLLPSGPRPGYAAIEALLSSRGVQPVSFSDWEKLDAEEVSRGKGAGKPREKL
LDPQEMLRLLGR
Download sequence
Identical sequences M3YRR3
XP_004749042.1.14098 ENSMPUP00000014023 ENSMPUP00000014023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]