SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014247 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014247
Domain Number 1 Region: 46-185
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 4.58e-46
Family Molybdopterin synthase subunit MoaE 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014247   Gene: ENSMPUG00000014356   Transcript: ENSMPUT00000014475
Sequence length 190
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:31571397:31582522:1 gene:ENSMPUG00000014356 transcript:ENSMPUT00000014475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLEINSSSFNQETKLPSSPPLVEGSACEPLGEDLNEVEENSKDIIKFTSEKLSIDEVS
QLVISPLCGAVSLFVGTTRNNFEGKKVISLEYEAYLPMAENEIRKICSDIRQKWPVKHIA
VFHRLGSVPVSEASIIIAVSSAHRAESLQAVSYAIDTLKAKVPIWKKEMYEESSSSWKKN
KECFWATVLF
Download sequence
Identical sequences M3YSD7
ENSMPUP00000014247 ENSMPUP00000014247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]