SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014258 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014258
Domain Number 1 Region: 131-186
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000186
Family VPS37 C-terminal domain-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014258   Gene: ENSMPUG00000014366   Transcript: ENSMPUT00000014486
Sequence length 308
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897050.1:4169854:4203677:1 gene:ENSMPUG00000014366 transcript:ENSMPUT00000014486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTALPWCRTTLQKAPAPARAWEVKSQESTHRRAGKMETLKDKTLEELEEMQNDPEAINRL
AQEAPEVQDLQLEREMALATNRSLAERNLEFQGPLEISRSNLSDKYQELRKLVERCQEQK
AKLEKFSSALQPETLLDLLQIEGMKIEEESEAMAEKFLEGEVPLETFLENFSSMRMLSHL
RRVRVEKLQDVMRKPRVSQEPAGDAPPPRPPPPPRPAPPATPPVAKEPSPPPSVVPPYPL
PYSPSPGIPAGPTAQGPLQPAPFPVLSQPSFPYGGPLGPPYPAAHPGPRGAAGYPWSPQR
STPPRPGY
Download sequence
Identical sequences M3YSE8
ENSMPUP00000014258 ENSMPUP00000014258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]