SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014425 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014425
Domain Number 1 Region: 115-159
Classification Level Classification E-value
Superfamily LysM domain 0.0000000196
Family LysM domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014425   Gene: ENSMPUG00000014535   Transcript: ENSMPUT00000014657
Sequence length 970
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896902.1:19925315:20079595:1 gene:ENSMPUG00000014535 transcript:ENSMPUT00000014657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMDTKEEKKERKQSYFARLKKKKQAKQNAETASAVATRTHTGKEDAKAVILEQDKANIAV
EEEYITDEKKKRKNNQLKEIRRTELKRYYSTDDNQNKTHDKKEKKMVVQKPHGTMEYTAG
SQDTLNSIALKFNITPNKLVELNKLFTHTIVPGQVLFVPDANFPSSTLRFSSSSPGATVS
PSSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVGGV
MIVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSDLPQ
DLCPLYRPGEWEDLASEKDINPFSKFKSLTKEKRQQNGERSISSDSKSVRPLEKSTEHTY
MKPSDSSLSGKLEILESSTEATSGSTTVTKVSKEPSDTRAAFESIAKENSLLGEDDDFVD
LEELSSQPDSGMDKRDTSKECLSLDPREIRKAKSHIIGSTTEMQVQSALNFSGADNDAEL
KETLDLETCEKQDIMPEVDKQSGSPESQVENTLNIHEDLDKVKLIEYYLNKNKEGSQLTE
NLQKAELSDAKKTEPVGIDITLSSSLPQVSGPPTEGSKEPDKTWVKDRVSLPLQLASSTE
ENVNKGSLDTASESTLDNSCQGAQMDNKSEIQLWLLKRIQVPIEDMLPSKEEKSKTPPMF
LCIKVGKPMRKSFATQSAAMVQQYGKRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYGKD
AKEQGFVVVEKEELNMIDNFFSEPTTKSWEIITVEEAKRRKSTCGYYEDDEEAALPVLQP
HSALLENMHIEQLARRLPARVQGYPWRLTYSTLEHGTSLKTLYRKSASLDSPVLLVIKDM
DNQIFGAYATHPFKFSDHYYGTGETFLYTFSPNFKVFKWSGENSYFINGDISSLELGGGG
GRFGLWLDADLYHGRSNSCSTFNNDILSKKEDFIVQDLELKKKTLLTLTYSGNTGIQRNN
SALNPYNNPS
Download sequence
Identical sequences M3YSW5
ENSMPUP00000014425 ENSMPUP00000014425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]