SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014475 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014475
Domain Number 1 Region: 224-385,446-508
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.4e-39
Family Voltage-gated potassium channels 0.0049
Further Details:      
 
Domain Number 2 Region: 511-695
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.36e-35
Family cAMP-binding domain 0.001
Further Details:      
 
Domain Number 3 Region: 41-135
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.55e-21
Family Flavin-binding PAS domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014475   Gene: ENSMPUG00000014586   Transcript: ENSMPUT00000014708
Sequence length 1083
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897186.1:587895:604404:-1 gene:ENSMPUG00000014586 transcript:ENSMPUT00000014708 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAMRGLLAPQNTFLDTIATRFDGTHSNFVLGNAQVTGLFPVVYCSDGFCDLTGFSRAEV
MQRGCACSFLYGPDTSELVRQQIRKALDEHKEFKAELILYRKSGLPFWCLLDVIPIKNEK
GEVALFLVSHKDISDTKNRGGPDNWKERGGGRRRYGRGRAKGFNANRRRSRAVLYHLSGH
LQKQPKGKHKLNKGVFGEKPNLPEYKVAAIRKSPFILLHCGALRATWDGFILLATLYVAV
TVPYSVCVSTAREPSAARSAPSICDLAVEVLFILDIVLNFRTTFVSKSGQVVFAPKSICL
HYVTTWFLLDVIAALPFDLLHAFKVNVYFGAHLLKTVRLLRLLRLLPRLDRYSQYSAVVL
TLLMAVFALLAHWVACVWFYIGQREIESSASELPEIGWLQELARRLETPYYLVGQSPATG
NSSGRSDNCSSISGEANGTGLELLGGPSLRSAYITSLYFALSSLTSVGFGNVSANTDTEK
IFSICTMLIGALMHAVVFGNVTAIIQRMYARRFLYHSRTRDLRDYIRIHRIPKPLKQRML
EYFQATWAVNNGIDTTELLQSLPDELRADIAMHLHKEVLQLPLFEAASRGCLRALSLALR
PAFCTPGEYLIHQGDALQALYFVCSGSMEVLKGGTVLAILGKGDLIGCELPRREQVVKAN
ADVKGLTYCVLQCLQLAGLHESLALYPEFAPRFSRGLRGELSYNLGAGGGPAEADTSSLS
GDNTLMSTLEEKETDGEQGPTVSPAPADEPSSPLLSPGCTSSSSAAKLLSPRRTAPRPRL
RGRGRPGRAGASQAEAGPSVHPRSLEGLQLPSVPWNMPPDLSPRVVDGIEDGCGSDQPKF
SFRVGQSGPECSSSPSPGPENGLLAVPLGPGEARNTDTLDKLRQAVTELSEQVLQMREGL
QSLRQAVQQVLAPHGEGPCPRASGEGPCLSSASGLLQPLCVDTGTSSYCLQPPAGSVLSG
TWPHPRPGPPPLVAAWPWGPPASQSSPWPRATAFWTSTSDSEPPGSGELCPEPSTPGSPP
AEEGTRTGPPEPTHQAEAASTGEPPPGSGGLALPWEPHSLEMVLIGCHGSGTVQWTQEEG
TGV
Download sequence
Identical sequences M3YT15
ENSMPUP00000014475 XP_004778927.1.14098 ENSMPUP00000014475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]