SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014623 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014623
Domain Number 1 Region: 34-146
Classification Level Classification E-value
Superfamily FKBP-like 7.07e-36
Family FKBP immunophilin/proline isomerase 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014623   Gene: ENSMPUG00000014732   Transcript: ENSMPUT00000014856
Sequence length 200
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897186.1:1141813:1149620:1 gene:ENSMPUG00000014732 transcript:ENSMPUT00000014856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRPSLLPLRLLLLLLSGVMCRAEAGFETESPVRSLQVETLVEPPEPCAEPAAFGDTLH
IHYTGSLVDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPSHLAYGK
RGFPPSIPADAVLQFDVELIALIRANYWQKLVKGILPLVGMAMVPALLGLIGYHLYKKAN
RPKVSKKKLKEEKRNKSKKK
Download sequence
Identical sequences M3YTG3
ENSMPUP00000014623 XP_004778960.1.14098 ENSMPUP00000014623

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]