SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014698 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014698
Domain Number 1 Region: 7-486
Classification Level Classification E-value
Superfamily ALDH-like 2.36e-163
Family ALDH-like 0.0000000183
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014698   Gene: ENSMPUG00000014807   Transcript: ENSMPUT00000014931
Sequence length 487
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896902.1:28329622:28351570:-1 gene:ENSMPUG00000014807 transcript:ENSMPUT00000014931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGTKALLTLENFINGKFVPCNSYLDSYDPSTGEVYCRVPNSGKEEIEAAVEAARAAFPG
WSARSPQERSQVLHRLADLLEQSLEELAQAESRDQGKTVTLARTMDIPRSVQNFRFFASS
ILHHTSECTHMDHLGCLHYTVRAPVGIAGLISPWNLPLYLLTWKVAPALAAGNTVIAKPS
ELTSVTAWMMCKLLEKAGVPPGVVNIVFGTGPRVGEALVSHPEVPLISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAIIFEDANLEECIPTTVRSSFANQGEICLCTSRIFVQKSIY
SEFLEKFVQATRMWKVGIPSDPSASMGALISKAHLEKVRSYIKRARSEGAQILCGEGVDT
LSLPPRNCAGYFMLPTVITDIKDESCCMKEEIFGPVTCVVPFDSEDEVIQRANSVKYGLA
ATVWSSNVGRIHRVAKKLQSGLVWTNCWLIRELNLPFGGMKSSGVGREGAKDSYEFFTEV
KTITIKH
Download sequence
Identical sequences M3YTN8
XP_004740302.1.14098 ENSMPUP00000014698 ENSMPUP00000014698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]