SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014827 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014827
Domain Number 1 Region: 28-479
Classification Level Classification E-value
Superfamily Sema domain 3.79e-116
Family Sema domain 0.00018
Further Details:      
 
Domain Number 2 Region: 1603-1730,1918-2104
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.96e-46
Family p120GAP domain-like 0.013
Further Details:      
 
Domain Number 3 Region: 1069-1164
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000484
Family Other IPT/TIG domains 0.017
Further Details:      
 
Domain Number 4 Region: 1161-1253
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000215
Family Other IPT/TIG domains 0.032
Further Details:      
 
Domain Number 5 Region: 482-533
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000994
Family Plexin repeat 0.0025
Further Details:      
 
Domain Number 6 Region: 1251-1295,1325-1378
Classification Level Classification E-value
Superfamily E set domains 0.0000000000271
Family Other IPT/TIG domains 0.048
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000014827
Domain Number - Region: 1393-1443
Classification Level Classification E-value
Superfamily E set domains 0.0143
Family E-set domains of sugar-utilizing enzymes 0.063
Further Details:      
 
Domain Number - Region: 638-671
Classification Level Classification E-value
Superfamily Plexin repeat 0.017
Family Plexin repeat 0.0081
Further Details:      
 
Domain Number - Region: 1028-1068
Classification Level Classification E-value
Superfamily Plexin repeat 0.0279
Family Plexin repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014827   Gene: ENSMPUG00000014938   Transcript: ENSMPUT00000015062
Sequence length 2137
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:2079927:2100901:1 gene:ENSMPUG00000014938 transcript:ENSMPUT00000015062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALGPALLQALWAGWVLALQPSPPAAFAPNGTHLQHLAQDPTSGTLYLGATNFLFQLSP
GLQLEAAVSTGPVLDSRDCLPPVMPDECPQAQATNNLNQLLLVSPGALVVCGSVHQGVCE
LRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRTLWPLDPQTAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQ
SRAFRAYVSRVCLRDQHYYSYVELPLACQGGRYGLLQAAAVATSLEVAQGEVLFAAFSSA
APPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAENDVEVAYIEYDV
NSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGVQLTAVAVTVEDGHTIAF
LGDSQGQLHRVYLGPGSDGHSYSTQNIQQGSAVSKDLTFDGAFEHLYVMTQSTLLKVPVA
SCGQHLDCASCLAHRDPYCGWCVLLGRCSRHSECSRGQGPERWLWSFQPELGCLHVAAMS
PANISREERREVFLSVPDLPPLWPGESYSCQFGDHQSPALLTSAGVMCPSPDPSEAPTLP
RGADHVSMSVELRFGAVVIAKASLSVYDCVAVTELRPSAPCQACVSSRWGCNWCVWQQLC
THKASCDAGPMVVSQQSPLLSPAPPAGDVPTPFPPRSPQAPVTSVPDTLPVEPGVPSTAT
ASAVPPGDRPSLLSPWGPGAGPGPVPASASTESPLHEEPPPPDPPNRPGTAVPAPTDSGP
TATPEDLSASHPSPSDAAALPPAPADPGPEADPSAALLDQPPGTAPTTTFPGAAGSVKPA
PDWLTREGGELPEADEWTGGDTPAFSTSTLLSGDGDSAEHEGPPAPLILLSSLDYQYDTP
GLWELEEVNRGPSACPCVDSVQGSMLMPVHVEREVQLLGRNLGLLQDSPGDSECVMELEG
REVVVEAWVECEPPPDTQCRVTCRRHQFSYEALQPELRVGLFLRRAGRLRVDSADGLHVV
LYDCSVGHGDCSRCQTARPQYGCVWCKGERPRCVAQEACGETEAVAAQCPAPLIHSVEPL
TGPVDGGTRVTIRGSNLGQHVQDVQNTVRVAGVPCAVDVLEYEVSSSFVCVTEASGGEVA
GTVTVEVPGRGRGISEHDFAYQDPKVYSIFPTRGPRAGGTHLTLHGSKLLTGRLEDLRVV
VGDQPCHLLLEQQADRLQCETSPRPMPATLPVAVWFGATERRLQHSQFEYTSDPNVTSAG
PTKSFLSGGRKIWVRGQNLDVVQTPRIRVTVAPRALLPSQGLGRRRRVIPETPCSPGASC
GGHHFEEPCHVNSSQLITCHTPALPGLPEDPWVRVEFILDNLVFDFAMLSPTPFSYEADP
ILQPLNPEDPTMPFRHKPGSVLSVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRHHLYCE
PPMEQPLPRHHALRETPDALPEFTVQMGNLRFSLGHVQYDGESPVAFPMAAQVGLGVGTS
LLALGVIIIVFIYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDL
LGSGIPFLDYKVYAERVFFPGHQESPLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTK
FIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPKLMLRR
TETVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNR
LLREDVEYRPLTLNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLAQRP
DPRTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVL
RENQDYVPGERTPMLEDVDEGGIRPWHLVKPSEEPEPPRPRRGSLRGGERERAKAIPEIY
LTRLLSMKGTLQKFVDDLFQVILSTSRPVPLAIKYFFDLLDEQAQQHGISDQDTVHIWKT
NSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRDSPINKLLY
ARDIPRYKRMVERYYADIRQTVPASDQEMNSILAELSRNYSGDLGARVALHELYKYINKY
YDQIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences M3YU17
ENSMPUP00000014827 XP_012915945.1.14098 XP_012915947.1.14098 XP_012915948.1.14098 XP_012915949.1.14098 ENSMPUP00000014827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]