SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014835 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014835
Domain Number 1 Region: 486-670
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.57e-44
Family cAMP-binding domain 0.00034
Further Details:      
 
Domain Number 2 Region: 216-391,421-482
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.1e-44
Family Voltage-gated potassium channels 0.0025
Further Details:      
 
Domain Number 3 Region: 4-96
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.62e-19
Family Flavin-binding PAS domain 0.000022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014835   Gene: ENSMPUG00000014946   Transcript: ENSMPUT00000015070
Sequence length 927
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896922.1:14935512:14955420:-1 gene:ENSMPUG00000014946 transcript:ENSMPUT00000015070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENCAIIYCNDGFCELFGYSRVEVMQRPCTCDFLTGPNTPRSAMSRLAQALLGTEECKVD
ILYYRKDASSFRCLVDVVPVKNEDGAVIMFILNFEDLAQLLAKSERRSLSQCLLSQSFLG
SESSHGRPGAQGPGTGRVKYRTIGQIPQFTLNFVEFNLEKHRSGSTTEIEIIAPHKVVER
TQNVTEKVTQVLSLGADVLPEYKLQAPRIHRGTLLHYSPFKAVWDWLILLLVIYTAIFTP
YSAAFLLSDQDESQRVDCGYTCSPLTVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPR
RIAIHYFKGWFLIDMVAAIPFDLLIFRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSE
YGAAVLFLLMCTFALIAHWLACIWYAIGNVERPYLEPKIGWLDSLGAQLGKRYNGSDPAS
GPSVQDKYVTALYFTFSSLTSVGFGNVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAII
QRLYSGTARYHTQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPEC
LQADICLHLHRALLQHCPAFRGASKGCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFIS
RGSIEILRDDVVVAILGKNDIFGEPISLHARPGKSSADVRALTYCDLHKIQRTDLLEVLD
MYPAFADSFWSKLEVTFNLRDAGGGFQSSPQPAPGSQDHQAFFLGDNQSAAAPSLSISDA
SGLWPELLQQVPPKPRHSPPNPQGDPDCWPRELGSRLEQLQAQMNRLESRMSSDLSRILQ
LLQHPPPQGHAGCILGAPMSDDLALFPAASATQSPGTRLPPGGLTPEQVPSCGDLNKYRL
TRRNSSSRGPPLAPLAATDKILTVSSEQEQPEGLLSPLASPLHPLEVQGLICGPRFPSLP
EHLSSIPKQLEFQRHGSDPGLAGSWSP
Download sequence
Identical sequences M3YU25
ENSMPUP00000014835 ENSMPUP00000014835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]