SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014895 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014895
Domain Number 1 Region: 360-490
Classification Level Classification E-value
Superfamily C-type lectin-like 1.23e-41
Family C-type lectin domain 0.0000858
Further Details:      
 
Domain Number 2 Region: 217-352
Classification Level Classification E-value
Superfamily C-type lectin-like 2.53e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 813-939
Classification Level Classification E-value
Superfamily C-type lectin-like 1.54e-34
Family C-type lectin domain 0.00032
Further Details:      
 
Domain Number 4 Region: 501-637
Classification Level Classification E-value
Superfamily C-type lectin-like 5.74e-34
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 5 Region: 952-1103
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-33
Family C-type lectin domain 0.0004
Further Details:      
 
Domain Number 6 Region: 644-788
Classification Level Classification E-value
Superfamily C-type lectin-like 4.39e-29
Family C-type lectin domain 0.00037
Further Details:      
 
Domain Number 7 Region: 1241-1379
Classification Level Classification E-value
Superfamily C-type lectin-like 9.97e-27
Family C-type lectin domain 0.0024
Further Details:      
 
Domain Number 8 Region: 23-154
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.34e-24
Family Cysteine rich domain 0.0054
Further Details:      
 
Domain Number 9 Region: 1110-1230
Classification Level Classification E-value
Superfamily C-type lectin-like 8.05e-23
Family C-type lectin domain 0.0012
Further Details:      
 
Domain Number 10 Region: 154-212
Classification Level Classification E-value
Superfamily Kringle-like 1.6e-20
Family Fibronectin type II module 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014895   Gene: ENSMPUG00000015005   Transcript: ENSMPUT00000015131
Sequence length 1473
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896922.1:15620646:15642874:-1 gene:ENSMPUG00000015005 transcript:ENSMPUT00000015131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVPPLLLMRSLEKHTVPSLPQPNVFLIFSHGLQGCLEAQGGQVRVSPACNASLPAQRWK
WVSRNRLFSLGTMQCLGTGWPGTNTTASLGMYECDREALNLRWHCRTLGDQLSQLLGGRT
GNMSKAGGPERGDQTRSGQWRIYGSDEDLCARPYYEVYTIQGNSHGKPCTIPFKYDNQWF
HSCTSTGREDGHLWCATTQDYGKDERWGFCPIKSNDCETFWDKDQLTDSCYQFNFQSTLS
WREAWASCEQQGADLLSITEIHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLK
YLNWESDQPDNPSEENCGVIRTESSGGWQNRDCSIALPYVCKKKPNATAERPPPDVWANV
KVECEPSWQAFQGHCYRLQAEKRSWQESKKACLRAGGDLLSIHSMAELEFITKQINTAEV
EELWIGLNDLKLQMNFEWSDGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCN
QSLPSICKKAGQLSQGAAEEDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLV
TITNRFEQAFVSSLIYNWDGEYFWTALQDLNSTGSFRWLSGDDVMYTHWNRDQPGYSRGG
CVALATGSAMGLWEVKNCTSFRARYICRQSLGTPVTPEVPGPDPTPSLTGSCPQGWGSDP
KLRHCYKVFSSERLQDKKTWLQAQGACRELGAQLLSLASYEEEHFVANMLNMSGKYHQNW
FWIGLNRRDPGAGQSWRWSDGLGFSYHNFDRSRHDDDDIRGCAVLDLASLQWVAMQCETQ
LDWICKIPRGWGSSRQPQPGLCSRTPTVPAGRREWLRFQEAEYKFFEHHSTWAQAQRICT
WFQAELVSVHSQAELDFLGHNLQKLSPGQEQHWWIGLHTAESDGRFRWTDGSIINFISWA
PGKPRPIGKDKKCVYMTASREDWGDQRCLTALPYICKRSNSTGEPQPPDLPPTALGGCPS
GWNQFLNKCFRIQGQDPQDRVKWSEAQFSCEQQEAQLVTIANPLEQAFITASLPNVTFDL
WIGLHASQRDFRWVEQEPLLYTNWAPGEPSGPSPAPSGNIPTSCAVVLHSPSAHLTGRWD
DRSCAEETHGFICQKGADPSLSPSPAASPPAPGTELSYLNGTFRLLQKPLRWQDALLLCE
SRNASLAHVPDPYTQAFLTQAARGLRTPLWIGLASEESWVSEEPLSYASWQDGEPQQPGG
CAYVDVDGAWRTASCDTKLQGAVCSASGGPPPPRRISYHGSCPQGLTDSAWIPFREHCYS
FHMELLLGHKEALQRCQRAGGAVLSILDEMENVFVWEHMQSSEGQSRGAWLGMNFNPKGG
ILVWQDNTAVNYSNWGPPGLGPSMLSHNSCYWIQSSSGLWRPGACTNVTMGVVCKLPRVI
AAPTRSTLFLAAEESSFSPSAALPENPAALVVVLMAVLLLLALLTAALILYRRRQSAERG
TFEGARYSRSASGPGEATEKNILVSDMEMNEQQ
Download sequence
Identical sequences M3YU85
ENSMPUP00000014895 ENSMPUP00000014895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]