SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014944 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000014944
Domain Number - Region: 302-335
Classification Level Classification E-value
Superfamily Plexin repeat 0.000384
Family Plexin repeat 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014944   Gene: ENSMPUG00000015055   Transcript: ENSMPUT00000015181
Sequence length 500
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897006.1:1597299:1653520:1 gene:ENSMPUG00000015055 transcript:ENSMPUT00000015181 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAELWLLVLVFREAARALSPPPGAGQDAGRGSGWAAKGTTQGWSRRARESPGQVLESDR
TQLSQEPGGGTLAIDTLPDNRTRVVEDNHNYYVSRLYGPNEPRSRELWVDVAKANQSQVK
VHRILSNTHRQASRVVLSFDFPFYGHPLRQITIATGGFIFMGDTIHRMLTATQYVAPLMA
NFNPGYSENSTVAYFDNGTVFIVQWDHVYLQGREDRGSFTFQAALHHDGRIVFGYKEIPM
PVLEISSSQHPVKAGLSDAFMILNPSPDVPESRRRTIFEYHRVELDPSKVTSTSAVEFTP
MPTCLQHQSCDACVSSDLTFNCSWCHVLQRCSSGFDRYRQEWLAYGCAQEAEGRTCEDFR
DEGHYSASPNSSFSPFDGDLTTTSSSLFIDSLTTEDDTKLNPYAGGEGLQNNLSPKTKGP
PVHLGTIVGIVLAVLLVAAIVLAGIYINGHPTSNAALFFIERRPHHWPAVRFRNHPNHST
YTEVEPSGHEKEGFVEAEQC
Download sequence
Identical sequences M3YUD4
ENSMPUP00000014944 XP_004764739.1.14098 ENSMPUP00000014944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]