SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000014982 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000014982
Domain Number 1 Region: 45-284
Classification Level Classification E-value
Superfamily PLP-binding barrel 2.24e-61
Family Alanine racemase-like, N-terminal domain 0.0000000723
Further Details:      
 
Domain Number 2 Region: 249-418
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.93e-31
Family Eukaryotic ODC-like 0.0000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000014982   Gene: ENSMPUG00000015093   Transcript: ENSMPUT00000015219
Sequence length 460
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:14802205:14840396:-1 gene:ENSMPUG00000015093 transcript:ENSMPUT00000015219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGYLSETDFVMVEEGFSTRDLLEELTLGASQATAGDVAAFFVADLGAVVRKHFCFLKCL
PRVRPFYTVKCNSSPGVLKVLAELGLGFSCANKAEMELVQRIGVPASKIIYANPCKQIAQ
IKYAAKHGVRLLSFDNEMELAKVVKGYPSARMVLGIATDDRHSLSPLSFKFGASLQSCRH
LLENAKRSHVEVVGVSFHVGSGCPDLHAYAQSIADARLVFEMGAELGHRMHLLDLGGGFP
GLEGAKVRFEEIASVINSALDLYFPEGCGVDILARLGRYYVTSAFTLAVSIIAKKEVLLD
QPGREEESGSIPKTIVYHLSEGVYGIFNSVLFDNTCPTPILQKKSSVDQPLYSSSLWGPV
ADGQDCVAEGLWLPQLHVGDWLVFENMGAYTVGMASLLGGTQTCRVTYAMSRVAWEALRG
QLLPTEQDEDTEGMCKPLSCGWEITDTLCVGPVFTPASIM
Download sequence
Identical sequences M3YUH2
ENSMPUP00000014982 ENSMPUP00000014982 NP_001280671.1.14098 XP_012919710.1.14098 XP_012919713.1.14098 XP_012919714.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]