SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015018 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015018
Domain Number 1 Region: 44-280
Classification Level Classification E-value
Superfamily PLP-binding barrel 6.21e-63
Family Alanine racemase-like, N-terminal domain 0.000000127
Further Details:      
 
Domain Number 2 Region: 248-416
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 8.16e-34
Family Eukaryotic ODC-like 0.0000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015018   Gene: ENSMPUG00000015128   Transcript: ENSMPUT00000015255
Sequence length 448
Comment pep:known scaffold:MusPutFur1.0:GL897038.1:1789105:1817294:1 gene:ENSMPUG00000015128 transcript:ENSMPUT00000015255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGFLDDANYSIGLLDEGTNLGNVIDNYVYEHTLTGKNAFFVGDLGKIVKKHSQWQNIVA
QIKPFYTVKCNSTPAVLEILAALGTGFACSSKTEMALVQELGVSPENIIYISPCKQVSQI
KYAAKIGVNIMTCDNEVELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHL
LECAKELDVQITGVKFHVSSACKESQVYVHALSDARCVFDMAREFGFTMNMLDIGGGFTG
TEFQLEEVNHVISPLLDVYFPEGSGIKIISEPGSYYVSSAFTLAVNIIAKKVVENDKFSS
GVEKTGSDEPAFMYYMNDGVYGSFASKLSEDLNTIPAVHKKYKEDEPLFTSSLWGPSCDE
LDQIVESCLLPELNVGDWLIFDNMGADSLHEPSAFNDFQRPAIYYMMSFSDWYEMQDAGI
TSDTMMKNFFFVPSCIQLSQEDSFSSEA
Download sequence
Identical sequences M3YUK8
ENSMPUP00000015018 NP_001278484.1.14098 NP_001288706.1.14098 ENSMPUP00000015018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]