SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015030 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015030
Domain Number 1 Region: 154-272
Classification Level Classification E-value
Superfamily DNA clamp 3.45e-18
Family DNA polymerase processivity factor 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000015030
Domain Number - Region: 27-99
Classification Level Classification E-value
Superfamily DNA clamp 0.0201
Family DNA polymerase processivity factor 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015030   Gene: ENSMPUG00000015139   Transcript: ENSMPUT00000015267
Sequence length 281
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896898.1:42855056:42860538:1 gene:ENSMPUG00000015139 transcript:ENSMPUT00000015267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLTPQIQDENDYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQA
NAFIQAGIFQEFIVQEESVTFRINLTVLLDCLSIFGSSPMPGTLTALRMCYQGYGYPLML
FLEEGGVVTVCKINTQEPEETLDFDFCSTNVINKIILQSEGLREAFSELDMTSEVLQITM
SPDKPYFRLSTFGNAGSSHLDYPKDSDLMESFHCNQTQVNRYKISLLKPSTKALVLSCKV
SIRTDNRGFLSLQYMIRNEDGQICFVEYYCCPDEEVPESES
Download sequence
Identical sequences M3YUM0
XP_004738098.1.14098 XP_004738099.1.14098 XP_006735593.1.47382 XP_021551783.1.83697 ENSMPUP00000015030 ENSMPUP00000015030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]