SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015144 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015144
Domain Number 1 Region: 4-130
Classification Level Classification E-value
Superfamily YjgF-like 4.87e-47
Family YjgF/L-PSP 0.000000583
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015144   Gene: ENSMPUG00000015253   Transcript: ENSMPUT00000015382
Sequence length 137
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897038.1:5832660:5848571:1 gene:ENSMPUG00000015253 transcript:ENSMPUT00000015382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLIRKVISTAKAPGAIGPYSQAVLVDRTIYISGQLGMDPASGQLVPGGVAEEAKQALK
NMGEILKAAGCDFSNVVKTTVLLADMNDFNTVNDVYKQYFKDSFPARAAYQVAALPKGGR
VEIEAVAVQGPLTTASL
Download sequence
Identical sequences M3YUY4
XP_004768971.1.14098 ENSMPUP00000015144 ENSMPUP00000015144

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]