SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015150 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015150
Domain Number 1 Region: 35-147
Classification Level Classification E-value
Superfamily Kringle-like 8.7e-28
Family Kringle modules 0.00091
Further Details:      
 
Domain Number 2 Region: 234-340
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-19
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015150   Gene: ENSMPUG00000015260   Transcript: ENSMPUT00000015389
Sequence length 477
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896925.1:13308415:13313201:-1 gene:ENSMPUG00000015260 transcript:ENSMPUT00000015389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRALASATSLWLGVMDTQAPQGLLLLLLFLPLLPPRGASAGSLHSPGLSECFQVNGADY
RGHQNRTGPRGAGRPCLFWDQTQQHSYSSASDPQGRWGLGPHNFCRNPDGDVQPWCYVAE
TEEGIYWRYCDIPTCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLA
GVEAGYACFCGSESDLDRGRPAPATDCDQICFGHPGQLCGGDGRLGIYEVSVGSCQGNWT
APQGVVYSPDFPDEYGPDRNCSWALSPPGAALELTFRLFELADPRDRLELRDAASGSLLR
AFDGARPPPPGPLRLRAAALRLTFRSDARGHAQGFALTYRGLQDADDDPEPKGSAQTPAA
PPDWANVSCSPRPGAPEAAMGARVFSTVTAISVLLLLFLSLLRLLRRRSCLLAPGKGPPA
LGPSRGPGRSWVVWYRRPGGVALPCPPTDSQAVGLAASYRPLSASSQSSLRSLISAL
Download sequence
Identical sequences M3YUZ0
ENSMPUP00000015150 XP_004750677.1.14098 ENSMPUP00000015150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]