SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015429 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015429
Domain Number 1 Region: 34-120
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.62e-19
Family Chaperone J-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015429   Gene: ENSMPUG00000015540   Transcript: ENSMPUT00000015670
Sequence length 256
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:18697642:18723474:1 gene:ENSMPUG00000015540 transcript:ENSMPUT00000015670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGEMAAPGESGASAGGGSTEEAFMTFYSEVKQIEKRDSVLTSKNQIERLTRPGSSYFNLN
PFEVLQIDPEVTDEEIKKRFRQLSILVHPDKNQDDADRAQKAFEAVDKAYKLLLDQEQKK
RALDVIQAGKEYVEHTVKERKKQLKKEGKPTNVEEDDPELFKQAVYKQTMKLFAELEIKR
KEREAKEMHERKRQREEEIEAQEKAKREREWQKNFEESRDGRVDSWRNFQANTKGKKEKK
NRTFLRPPKVKMEQRE
Download sequence
Identical sequences M3YVR9
ENSMPUP00000015429 ENSMPUP00000015429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]