SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015464 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015464
Domain Number 1 Region: 427-769
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.77e-109
Family PDEase 0.00000138
Further Details:      
 
Domain Number 2 Region: 165-268
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000366
Family Heme-binding PAS domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000015464
Domain Number - Region: 38-109
Classification Level Classification E-value
Superfamily CheY-like 0.000111
Family CheY-related 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015464   Gene: ENSMPUG00000015574   Transcript: ENSMPUT00000015705
Sequence length 773
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896996.1:3649180:3765154:-1 gene:ENSMPUG00000015574 transcript:ENSMPUT00000015705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLRLLVAVADVQFGPMRFHPDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAV
LACFLDKHHDIIIIDHRNPRQLDAEALCRSIRSSKLSENTIIIGVVRRTDREESSVMPLI
AAGFTRRYVENPSLMACYNELLQLEFGEVRSQLKLRACNSVFTALEKSQEAIEITSEDRV
IQYANPAFETTMGYQSGELIGKELAEVPINEKKADLLDTINSCIRIGKEWQGIYHAKKKN
GDNVQQNVKIIPVVGQGGKIRHYVSIIRVCNGSNKAEKITECVQSDPHTDNQSGKHKDRR
KSSLDVRTLASRASEGGSQRRHSSMARIHSMTIEAPITKVINIINAAQESSPVPVTEALD
RVLEILRTTELYSPQFGAKDDDPHANDLVGGLVSDGLRRLSGNEYVLSTKSLQQLPSGVI
TPISLHDIPPRIARAMENEEYWDFDIFELEAATHKRPLIYLGLKMFARFGICEFLNCSET
TLRSWLQVIEANYHSSNPYHNSTHSADVLHATAYFLCKERIKQTLDPVDEVAALIAATIH
DVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTRDDKCNIFKNMERNDYRT
LRQGIIDMVLATEMTKHFEHVNKFVNSINKPLAALEADGEVAKDEEAVNTMLRTPENRTL
VKRMLIKCADVSNPCRPLEQCIEWAARISEEYFSQTDEEKRQDLPVVMPVFDRNTCSIPK
SQISFIDYFITDMFDAWDAFVDLPELMQHLDNNFKYWKGLDEMKLRSLRPPPE
Download sequence
Identical sequences M3YVV4
ENSMPUP00000015464 ENSMPUP00000015464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]