SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015626 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015626
Domain Number 1 Region: 40-517
Classification Level Classification E-value
Superfamily Sema domain 4.19e-163
Family Sema domain 0.00000000293
Further Details:      
 
Domain Number 2 Region: 519-571
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000127
Family Plexin repeat 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015626   Gene: ENSMPUG00000015735   Transcript: ENSMPUT00000015867
Sequence length 831
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896996.1:4766291:4803858:-1 gene:ENSMPUG00000015735 transcript:ENSMPUT00000015867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWGSRPSAPRGALPPGPPTLLLLLLLLLPPPPTRALAPRISLPLGSQDRPFLRFGAENI
SNYTALLLSRDGKTLYVGAREALFALNSSASFLPGGAYQELSWSADADRKQQCSFKGKDP
QRDCQNYIKILLPLNTTHLFTCGTAAFSPVCTYISVENFTLAQDEMGRILLEDGKGRCPF
DPNFKSTALVVDSELYTGTVSSFQGNDPAISRSQSLRPTKTESSLNWLQDPAFVASAYIP
ESLGSLQGDDDKIYFFFSETGQEFEFFENTIVSRIARICKGDEGGERVLQQRWTSFLKAQ
LLCSRPEDGFPFNVLQDVFTLSPSPQDWRDTLFYGVFTSQWHRGTTEGSAVCVFTMRDVQ
NAFSGLYKEVNRETQQWYTVTHPVPSPRPGACITNSARERKIRSSLQLPDRVLNFLKDHF
LMDGQVRSHLLLLQPRARYQRVAVHRVRGLHHTYDVLFLGTGDGRLHKAVSVGSRVHIIE
ELQIFPHGQPVQNLLLDADRGLLYAASYSSVVQVPVASCSLYQSCGDCVLARDPYCAWSS
SRCRPVSLYGPETASRSWIQDIEGANTRGLCNTSSPGPRSPVLTGEKQCEQVDFPPNTVK
TLACPLLSNLATRLWLHNGLPVNTSASCRVLPTGDLLLVGGQQELGVFQCWSLEEGFRQL
VACYSPTVVEDRAADRGDRSGSVPVIISTSRVSAPAGSKASWGVDKSYWTEFLVMCTLFV
LAVVLLILFFLYRHRGGMKVFLKQGECASVHPKPRPMALPPETRPLNGVGPPSTPLDHRG
YQALSESSPAPRVFTESEKRPLSIQDSFVEVSPVCPRPRVRLGSEIRDSVV
Download sequence
Identical sequences M3YWB6
XP_012917440.1.14098 ENSMPUP00000015626 ENSMPUP00000015626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]