SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000015783 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000015783
Domain Number 1 Region: 155-257,425-496
Classification Level Classification E-value
Superfamily TrmE connector domain 1.7e-42
Family TrmE connector domain 0.0033
Further Details:      
 
Domain Number 2 Region: 106-186,225-415
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.91e-36
Family G proteins 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000015783   Gene: ENSMPUG00000015889   Transcript: ENSMPUT00000016024
Sequence length 496
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896974.1:6784878:6788428:-1 gene:ENSMPUG00000015889 transcript:ENSMPUT00000016024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWRGLWTLVAWAARGPRSPRSCTRQGSGAPAPGSGATIFALSSGQGRCGIAVIRTSGPAS
GHALRSLTAPRDLPPARSACLRLLSHPRSGEPLDRALVLWFPGPQSFTGEDCAEFHVHGG
PAVVSGVLQALGSVPGLRPAEAGEFTRRAFAHGKLSLTEVEGLADLIHAETEAQRRQALR
QLDGELGHLCHGWAKTLTKALAHVEAYIDFGEDDNLEEGVLERATADSQVRELELALSAH
LRDARRGQRLRSGAHVVVAGPPNAGKSSLVNLLSRKPVSIVSPEPGTTRDVLEIPVDLAG
FPALLSDTAGLREGVGPVEQEGVRRARERLQQADLILAVLDASDLASPSSRNFLDTVVAP
AGAGSPNESSQRLLLVLNKSDLLPPGGPGPSPNLPPHLLLSCLTGEGLDDLLEALRKELA
EVCGDPSTGPPLLTRARHQHHLQGCLDALGHYRQTKDLALAAEALRLARGHLGRITGGGS
TEEVLDIIFRDFCVGK
Download sequence
Identical sequences M3YWS3
ENSMPUP00000015783 ENSMPUP00000015783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]