SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016089 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016089
Domain Number 1 Region: 379-469,504-880
Classification Level Classification E-value
Superfamily ALDH-like 3.84e-100
Family ALDH-like 0.00000123
Further Details:      
 
Domain Number 2 Region: 1011-1430
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.38e-86
Family L-arabinose binding protein-like 0.00028
Further Details:      
 
Domain Number 3 Region: 190-258
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.00000000000141
Family Intermediate filament protein, coiled coil region 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016089   Gene: ENSMPUG00000016194   Transcript: ENSMPUT00000016333
Sequence length 1435
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:26165459:26257100:1 gene:ENSMPUG00000016194 transcript:ENSMPUT00000016333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WEEELAKRMNLQTMVDTLQEAAQEAEAIQEEMNEKIERLKAELVVFKGLMSDPMTDLDTK
IQEKAMKVDMDICRRIDITAKLCDVAQQRNSEDVSKIFQVVPKKKERKVASDDDISEQDG
EVNRFSDDEVGSMNITDEMKRMFNQLRETFDFDDDCDSLTWEENEDTLLLWEDFTNCNPS
IDLQGEQEENLGNLIHETESFFKTRDKEYQETIGQIELELATAKSDMNRHLHEYMEMCSM
KRGLDVQMETCRRLIKGSADRNSPSPSSVASSDSGSTDEIQDEFEREADVEPMPLEKILT
GNSEESSKSFNLRCVILIGQPALRRALLARPWREPGLWWKHTSSLPKVANEPVLAFTRGS
PERDALQKALKDLKGRTEAIPCVVGDEEVWTSDVRYQVSPFNHGHKVAKFCYADKGVLNK
AIGAALAARKEWDLKPVADRAQIFLKAADMLSGPRRAEVLAKTMVGQSPEVLPGPSCLSG
GTGSEGNVGRFQASCCLFQVLPGKTVIQAEIDAAAELIDFFRFNAKFAMELEGQQPLSVP
PSTNSVVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVVLWKPSDTAMLASYAVYRIL
REAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVPTFKHLWKQVAQNLDRFRTFP
RLAGECGGKNFHFVHRSADVDSVVSGTLRSAFEYGGQKCSACSRLYVPRSLWPQIKGRLL
EEHGRIKVGDPAEDFGTFFSAVIDAKSFSRIKKWLEHARSSPSLSILAGGKCDDSVGYFV
EPCIVESQDPQEPIMKEEIFGPVLTVYVYPDEEYKETLRLVDSTTSYGLTGAVFAKDKDV
VQEATALLRNTAGNFYINDKSTGSVVGQQPFGGARASASPGSVSLFLCLFYSMGPWARAV
CSLFILLWVLAAPAENSDFYLAGDYLLGGLFSLHANMKGIVHLNFLQVPQCKEILEPGGG
GLLILVMMQMVKSMVMMVVVVMVVTVMVVVIGMTVILEIWYGMGTMMYEMKVLGYNLLQA
MRFAVEEINNQSSLLPGVLLGYEMVDVCYISNNIQPVLYFLAREDYSLPIQEDYSHYVPR
VVAVIGPDNSESTTIVAHFLSLFLLPQITYSAISDELRDKNRFPSLLRTVPGADHQVEAM
VQLMLYFRWNWIILLVSSDDYGRYNGQLLNTRLATRDICIAFQETLPMPQPNQEVTPWER
QRLEAIVDKIQQSSARIVVLFSPDLALHNFFREVLRQNFTGAVWIASESWAIDPVLHNLT
ELRNTGTFLGVTAQSVPIPGFSEFRMRPPQAGPPAPTRTSLGATCNQECDSCQDTTASFS
TILTLSGERVAYSVYSAVYAVAHALHSLLRCTRTTCSKRVVYPWELLQEIWKVNFTLLGH
KIFFDKQGDLLMSLEVIQWQWDLSQNPFLSIASYYPALRQLKMGHNVSWHTANNT
Download sequence
Identical sequences M3YXM9
ENSMPUP00000016089 ENSMPUP00000016089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]