SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016454 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016454
Domain Number 1 Region: 17-171
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 6.08e-83
Family Hedgehog (development protein), N-terminal signaling domain 0.0000000807
Further Details:      
 
Domain Number 2 Region: 176-322
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 5.1e-39
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016454   Gene: ENSMPUG00000016557   Transcript: ENSMPUT00000016699
Sequence length 384
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896989.1:2606775:2613845:-1 gene:ENSMPUG00000016557 transcript:ENSMPUT00000016699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPGRGPRGANRGARQPLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNP
DIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYE
GRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGGCFPAG
AQVRLESGARVALSAVRPGDRVLAMGEDGNPTFSDVLIFLDREPDRLRAFRVIETQDPPR
RLALTPAHLLFTSNNHTEPAAHFRATFASQVQPGQYVLVAGVPGLQAARVAAVSTHVAVG
AYAPLTRHGTLVVEDVVASCFAAVADHRLAQLAFWPLRLFHSSVWGSWTPGEGVHWYPRL
LYRLGQLLLEEDSFHSLGMAGLGS
Download sequence
Identical sequences M3YYP4
ENSMPUP00000016454 ENSMPUP00000016454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]