SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016807 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016807
Domain Number 1 Region: 682-975
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.35e-105
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000209
Further Details:      
 
Domain Number 2 Region: 979-1265
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.65e-74
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000159
Further Details:      
 
Domain Number 3 Region: 1-204
Classification Level Classification E-value
Superfamily Carbonic anhydrase 5.5e-63
Family Carbonic anhydrase 0.0000224
Further Details:      
 
Domain Number 4 Region: 231-325
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000451
Family Fibronectin type III 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016807   Gene: ENSMPUG00000016911   Transcript: ENSMPUT00000017056
Sequence length 1300
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896899.1:11203317:11498456:1 gene:ENSMPUG00000016911 transcript:ENSMPUT00000017056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNTGKTVAILLKDDYFVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSINGRRFPVEMQI
FFYNPDDFDSFQTAISENRIIGAMAIFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPF
VLRDLLPASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHV
KSVEYLRNNFRPQQELNGRVVSKSAVRDAWNHDMTDFLENPLGTEASKVCSSPPVHMKVQ
PLNQTALQVSWSQPETIYHPPIMNYMISYSWTKNEDEKEKTFTKDSDKDLKATISHVSPD
SLYLFRVQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSG
SSTWTSSGIPFSFVSMATGMGPSSSGSQATVASVVTSTLLAGLGFSGGGIPSFPSTVWPT
RLPTAASASKQAVRPVLATTEALASPGPDGDSAPSKDSEGTEEGEKDEKSESEDGEREHE
DEGEKDPEKKKSGVTHAAQEPRQDEPTPTPSSANRTAEEGGHQTLPGPRQDRTAVPTDQP
DDVRDARPGLDSGSVTSTQVPPTVTEEHFQGSDSRRPQMPSKKPMSRGDRFSEDSKFITV
NPAEKNTSGMISRPSPGRMEWIIPLIVVSALTFVCLILLIAVLVYWRKCFQTAHFYVEDS
SSPRVVPNESIPIIPIPDDMEAIPVKQFVKHIGELYSNNQHGFSEDFEEVQRCTADMNIT
AEHSNHPDNKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQ
GPLKSTFEDFWRMIWEQNTGIIIMITNLVEKGRRKCDQYWPTENSEEYGNIIVTLKSTKV
HACYTVRRFSVRNTKVKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRS
SAARTPEMGPVLVHCSAGVGRTGTYIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQT
EEQYIFIHDALLEAILGKETEVSSNQLHSYVNSILIPGVGGKTRLEKQFKLVTQCNAKYV
ECFSAQKECNKEKNRNSSVVPSERARVGLAPLPGMKGTDYINASYIMGYYRSNEFIITQH
PLPHTTKDFWRMIWDHNAQIIVMLPDNQSLAEDEFVYWPSREESMNCEAFTVTLISKDRL
CLSNEEQIIIHDFILEATQDDYVLEVRHFQCPKWPNPDAPISSTFELINVIKEEALTRDG
PTIVHDEYGAVSAGMLCALTTLSQQLENENAVDVFQVAKMINLMRPGVFTDIEQYQFVYK
AMLSLVSTKENGNGPMTADKNGAVLIADESDPAESMESLV
Download sequence
Identical sequences M3YZP6
ENSMPUP00000016807 ENSMPUP00000016807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]