SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016842 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016842
Domain Number 1 Region: 35-505
Classification Level Classification E-value
Superfamily Sema domain 3.79e-146
Family Sema domain 0.00000000697
Further Details:      
 
Domain Number 2 Region: 508-556
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000119
Family Plexin repeat 0.00083
Further Details:      
 
Domain Number 3 Region: 569-658
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000255
Family I set domains 0.043
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000016842
Domain Number - Region: 767-776
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0994
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016842   Gene: ENSMPUG00000016946   Transcript: ENSMPUT00000017091
Sequence length 840
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896923.1:4430467:4439486:-1 gene:ENSMPUG00000016946 transcript:ENSMPUT00000017091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGRLWALFLSFLTATAVPGPSLRRPSRELDATPRMTIPYEELSRTRHFKGQAQNYSTLL
LEESSARLLVGARGALFSLNARDIGDGAHKEIRWEASPEMQSKCHQKGKNNQTECFNHVR
FLQRLNATHFYACGTHAFQPLCAAIDAEAFTLPASFEEGKEKCPYDPARGFTGLIIDGGL
YTATRYEFRSVPDIRRSRHPHALRTEEAPMQWLNDAEFVFSVLVRESEASAVGDDDKVYY
FFTERATDEGPSSFAQSRNSHRVARVARVCKGDLGGKKILQKKWTSFLKARLVCHIPQYE
LLRAVCSLDANASARTHFYAAFTLTTQWKTLEASAICRYDLAEVQAVFAGPYMEYQDGAR
RWGRYEGGVPEPRPGSCITDSLRTRGYNSSQDLPSLVLDFVKLHPLMARPVVPTRGRPLL
LKRNVRYTHLTGTPVSTPAGPTYDLLFLGTADGWIHKAVVLGSGMHIIEETQVFKEPQSV
ENLVISPVQHSLYVGAPSGVIQLPLSSCSRYHSCYDCILARDPYCGWDPGTHACIVFSRS
QSSRTTLIQDMERGNRGCEGHRDSGPPPPLKTRSVLRGDDVLLPCDQPSNLARALWLLNG
STGLSDGQHGYRVGVDGLLVTDIQPEHSGNYGCYAEENGLRTLLASYSLTVRPATPAPAP
QAPAMPGAQLAPDVRLLYVLAIAALGGLCLLLASSLLYVACLQGGRRGRRRKYSLGRAGR
AGGSAVQLQTVSGQCPGEEEEGDDGEGPGGLEGGCLQIIPGEGAPAPPPPPPPPPPAELT
NGLVALPSRLRRMNGNSYVLLRQSNNGVPAGPCSFAEELSRILEKRKHMQLVEHLDESSV
Download sequence
Identical sequences M3YZT1
ENSMPUP00000016842 XP_012910078.1.14098 XP_012910079.1.14098 ENSMPUP00000016842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]