SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016881 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016881
Domain Number 1 Region: 27-269
Classification Level Classification E-value
Superfamily CutC-like 6.93e-80
Family CutC-like 0.00000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016881   Gene: ENSMPUG00000016986   Transcript: ENSMPUT00000017131
Sequence length 273
Comment pep:known scaffold:MusPutFur1.0:GL896923.1:5419867:5455797:-1 gene:ENSMPUG00000016986 transcript:ENSMPUT00000017131 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQGASSERKRARIPSGKAGTANGFLMEVCVDSVESAVNAERGGAGRIELCSGLLEGGT
TPSMGVLQVVKQCVQIPVFVMIRPRGGDFLYSDREVEVMKADIRLAKLYGADGLVFGALT
EDGNIDKELCMSLVAICRPLPVTFHRAFDMVHDPMAALETLLTLGFERVLTSGCDSSALE
GLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARSARDSGMKFRNFSV
AMGASLSSSEYSQKVTDVAQVRTLNAIAKNILV
Download sequence
Identical sequences M3YZX0 U6CVK0
XP_004749568.1.14098 ENSMPUP00000016881 ENSMPUP00000016881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]