SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017087 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017087
Domain Number 1 Region: 424-561
Classification Level Classification E-value
Superfamily DNA-glycosylase 3.31e-34
Family Mismatch glycosylase 0.000000136
Further Details:      
 
Domain Number 2 Region: 58-178
Classification Level Classification E-value
Superfamily DNA-binding domain 1.08e-31
Family Methyl-CpG-binding domain, MBD 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017087   Gene: ENSMPUG00000017195   Transcript: ENSMPUT00000017341
Sequence length 565
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896899.1:35501756:35510310:-1 gene:ENSMPUG00000017195 transcript:ENSMPUT00000017341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGMESPSLGDCGAAPSVTSSERLAADPHCDLRQEDGALGLESMGENEKQVMIKSSSECN
LLLQESIASAQTSDTTMTECHKSVPCGWERVVKQRLSGKTAGRYDVYFISPQGLKFRSKS
SLVKYLHKNEETSLTPEDFDFTVLSKKGIKSRYKNRNVAPLTSQMQCESNSSNRNLRTRS
WWKKDVFPLPSSCLELQSSKGLSNFKDKGVTDMDSRKVRKSKEKVPILKGIQIKRNKTRC
QKGLPDSAQSNKKRKSEYKKANDESEPVVQESQLDKTLSIDAGTSNKTLSATSEEKKLVK
EQSLSLVSNFCSEQITSGIINKLCSTEEAEHSKKCEETFLESEEIKSKVQVGERKEHLHT
DVLKCGSEMDNNCSQTEKDSVEMCQEDTIPRTQIEKRKTSLYFSSKYNREALSPPRRKAF
KKWTPPRSPFNLVQETLFHDPWKLLIATIFLNRTSGKMAIPVLWEFLEKYPSAEVARTAD
WRDVSELLKPLGLYDLRAKTIIKFSDEYLTKQWRYPIELHGIGKYGNDSYRIFCVNEWKQ
VHPEDHKLNKYHDWLWENHEKLSLS
Download sequence
Identical sequences M3Z0H5
ENSMPUP00000017087 ENSMPUP00000017087 XP_004738628.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]