SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017150 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017150
Domain Number 1 Region: 42-250
Classification Level Classification E-value
Superfamily PHP domain-like 2.51e-44
Family RNase P subunit p30 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017150   Gene: ENSMPUG00000017258   Transcript: ENSMPUT00000017404
Sequence length 286
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896923.1:12662481:12694299:-1 gene:ENSMPUG00000017258 transcript:ENSMPUT00000017404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGASPAAAQTDARRSRDFSMAVFADLDLRAGSDLKALRGLVENAAHLGYSVVAINHVV
EFKEKKQEIEKPVAVSELFTTLPIVQGKSRPIKVLTRLTIIVSDPSHCNVLRATSSRVRL
YDIVAVFPKTEKLFHVACTHLDVDLVCITVTEKLPFYFKRPPINVAIDRGVGFELIYSPA
IKDSTMRRYTISNALNLMQVCKGKNVILSSAAERPLEIRGPYDVANLGLLFGLSESDAKA
AVSTNCRAVLLHGETRKTAFGIISTVKKPRPSEADDDSLPACKKAK
Download sequence
Identical sequences M3Z0N8
ENSMPUP00000017150 ENSMPUP00000017150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]