SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017211 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017211
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 1.96e-31
Family N-terminal domain of MutM-like DNA repair proteins 0.000000414
Further Details:      
 
Domain Number 2 Region: 133-244
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.62e-26
Family Middle domain of MutM-like DNA repair proteins 0.0000023
Further Details:      
 
Domain Number 3 Region: 248-290
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.13e-18
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017211   Gene: ENSMPUG00000017321   Transcript: ENSMPUT00000017467
Sequence length 344
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896963.1:6405289:6411450:1 gene:ENSMPUG00000017321 transcript:ENSMPUT00000017467 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEGPELHLASLYVNEACKGLVFAGCVEKSPVSRNPEVPFESSAYCISSSARGKELRLTL
SPLPGAQPPQEPLALVFRFGMSGSFQLVPRDALPAHAHLRFYTAPPGPPLALCFVDIRRF
GHWDLGGEWQPGRGPCVLLEYEQFRDNVLRNLADKVFDQPICEVLLDQRFFNGIGNYLRA
EILYRLKIPPFEKARKVLEELQQRRPSPELTLSQKIRAKLQNPDLLELCHSVPKEVVQLG
GKGYGPEHGEEDFAAFRAWLQCYGVPGMSSLRDRRGRTIWFQGDPGPLAPKGGKSRKKKS
KGAQQGLEHRLEVRLLPSFSPAPAAPPRSPPLTMGGKQWVLTNL
Download sequence
Identical sequences M3Z0U9
ENSMPUP00000017211 ENSMPUP00000017211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]