SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017253 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017253
Domain Number 1 Region: 59-528
Classification Level Classification E-value
Superfamily Sema domain 3.4e-130
Family Sema domain 0.0000184
Further Details:      
 
Domain Number 2 Region: 1372-1498,1693-1882
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.28e-53
Family p120GAP domain-like 0.026
Further Details:      
 
Domain Number 3 Region: 974-1062
Classification Level Classification E-value
Superfamily E set domains 9.29e-16
Family Other IPT/TIG domains 0.033
Further Details:      
 
Domain Number 4 Region: 1061-1165
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000107
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.077
Further Details:      
 
Domain Number 5 Region: 877-975
Classification Level Classification E-value
Superfamily E set domains 0.000000000000063
Family Other IPT/TIG domains 0.014
Further Details:      
 
Domain Number 6 Region: 531-583
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000017
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 7 Region: 1162-1252
Classification Level Classification E-value
Superfamily E set domains 0.000000504
Family E-set domains of sugar-utilizing enzymes 0.053
Further Details:      
 
Domain Number 8 Region: 830-862
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000458
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017253   Gene: ENSMPUG00000017363   Transcript: ENSMPUT00000017509
Sequence length 1912
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896899.1:40153140:40198151:-1 gene:ENSMPUG00000017363 transcript:ENSMPUT00000017509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMHASAGPECLGPRPRPAMPLPRLSLWALPLLLLLLLGGVPGAAGAPRAGGALQPAFRTF
SASDWGLTHLVVHEQTGEVYVGAVNRIYKLSGNLTLLRAHVTGPVEDNEKCYPPPSVQSC
PHGLGSTDNVNKLLLLDYAANRLLACGSASQGICQFLRLDDLFKLGEPHHRKEHYLSSVR
EAGSMAGVLIAGPPGQGQAKLFVGTPIDGKSEYFPTLSSRRLMANEEDADMFGFVYQDEF
VSSQLKIPSDTLSKFPAFDIYYVYSFRSEQFVYYLTLQLDTQLTSPDAAGEHFFTSKIVR
LCVDDPKFYSYVEFPIGCEQAGVEYRLVQDAYLSRPGRALARQLGLAEDEDVLFTVFAQG
QKNRVKPPKESVLCLFTLRAIKEKIKERIQSCYRGEGKLSLPWLLNKELGCINSPLQIDD
DFCGQDFNQPLGGTVTIEGTPLFVDKDDGLTAVAAYDYRGRTVVFAGTRSGRIRKILVDL
ANPSGRPALAYESVVAQESSPILRDLVLSPDRQYLYAMTEKQVTRVPVESCVQYTSCELC
LGSRDPHCGWCVLHSICSRQDACERADEPQRFASDLLQCVQLTVQPRNVSVTMSQVPLVL
QARNVPDLSAGVNCSFEDFTESESILEDGRIHCRSPSAREVAPITRGQGDQRVVKLYLKS
KETGKKFASVDFVFYNCSVHQSCLSCVNGSFPCHWCKYRHVCTHNAADCAFLEGRVNVSE
DCPQILPSTQIYVPVGVVKPITLAARNLPQPQSGQRGYECLFHIPGSPARVTALRFNSSS
LQCQNSSYSYEGNDVSDLPVNLSVVWNGNFVIDNPQNIQAHLYKCPALRESCGLCLKADP
RFECGWCVAERRCSLRPHCPADSPAAWMHARHGSSRCTDPKILKLFPETGPRQGGTRLTI
TGENLGLRFEDVRLGVRVGKVLCSPVESEYISAEQIVCEIGDASTVRAHDALVEVCVRDC
SPHYRALSPKRFTFVTPTFYRVSPARGPLSGGTWIGIEGSHLNAGSDVAVSVGGRPCSFS
WRNSREIRCLTPPGQSPGSAPIVININRAQLTNPEVKYNYTEDPTILKIDPEWSINSGGT
LLTVTGTNLATVREPRIRAKYGGVERENSCLVYNDTTMVCRAPSVDNPTRSPPELGERPD
ELGFVMDDVRALLVLNASSFLYYPDPVLEPLSPTGLLELKPSSPLILKGRNLLPPAPGNS
RLNYTVLIGSTPCALTVSETQLLCESPNLTGQHKVTVRAGGFEFSPGMLQVYSDSLLTLP
AIVGIGGGGGLLLLVIVAVLIAYKRKSRDADRTLKRLQLQMDNLESRVALECKEAFAELQ
TDIHELTNDLDGAGIPFLDYRTYAMRVLFPGIEDHPVLKEMEVQANVEKSLTLFGQLLTK
KHFLLTFIRTLEAQRSFSMRDRGNVASLIMTALQGEMEYATGVLKQLLSDLIEKNLESKN
HPKLLLRRTESVAEKMLTNWFTFLLYKFLKECAGEPLFMLYCAIKQQMEKGPIDAITGEA
RYSLSEDKLIRQQIDYKTLTLNCVNPENENAPEVPVKGLNCDTVTQVKEKLLDAVYKGVP
YSQRPKAGDMDLEWRQGRMARIILQDEDVTTKIDNDWKRLNTLAHYQVTDGSSVALVPKQ
TSAYNISNSSTFTKSLSRYESMLRTASSPDSLRSRTPMITPDLESGTKLWHLVKNHDHLD
QREGDRGSKMVSEIYLTRLLATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDE
QADQHQIHDSDVRHTWKSNCLPLRFWVNVIKNPQFVFDIHKSSITDACLSVVAQTFMDSC
STSEHKLGKDSPSNKLLYAKDIPNYKSWVERYYADIAKMPAISDQDMSAYLAEQSRLHLS
QFNSMSALHEIYSYITKYKDEILTALEKDEQARRQRLRSKLEQVVDTMALSS
Download sequence
Identical sequences M3Z0Z1
ENSMPUP00000017253 XP_004738720.1.14098 ENSMPUP00000017253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]