SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017266 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017266
Domain Number 1 Region: 133-699
Classification Level Classification E-value
Superfamily Urocanase 6.67e-225
Family Urocanase 0.000000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017266   Gene: ENSMPUG00000017376   Transcript: ENSMPUT00000017522
Sequence length 724
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896899.1:40665298:40708640:1 gene:ENSMPUG00000017376 transcript:ENSMPUT00000017522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPSAGPGPNEALEEVAVEQKVPARWTVTVRSLPDFPQSRPPSQPQPDMSSLQTLCSGLP
LRPLPENRGRWAGVSHAPVRTPGLSPLEEQLALRNALRYFPPDVQELLAPEFAQELRLYG
HIYMYRFCPTMKMRAYPIEQYPCRTRAAAAIMHMVMNNLDPAVAQFPQELVTYGGNGQVF
SNWAQFWLTMSYLSQMTEEQTLVMYSGHPLGLFPSTPWAPRLVITNGMVIPNYSSRTEYE
KLFAMGVTMYGQMTAGSYCYIGPQGIVHGTVLTVLNAGRRYLGVKDLTGKVFVTSGLGGM
SGAQAKAAVIVGCIGVIAEVDKAALMKRHEQGWLMEVTSSLDHCIERLREARKRKEVLSL
GYHGNVVDLWERLVHELDTTGELLVDLGSDQTSCHNPFNGGYYPVQLGFAEAQSLMASDP
AAFKGLVQESLRRQVSAINRLAKENFFFWDYGNAFLLEAQRAGADVEKKDASKTEFRYPS
YVQHIMGDIFSLGFGPFRWVCTSGDPQDLAVTDELATCVLEKAIADGVNLAVKLQYMDNI
RWIREAAKHRLVVGSQARILYSDQKGRVAIAVAFNQAIARGEIKAPVVLSRDHHDVSGTD
SPFRETSNIYDGSAFCADMAVQNFAGDAFRGATWVALHNGGGVGWGEVINGGFGLVLDGT
QEAEQKARMMLSWDVSNGVARRCWSGNQKAYEIICQTMQDNKGLVVTLPHEVADECMLQQ
ALRP
Download sequence
Identical sequences M3Z104
ENSMPUP00000017266 ENSMPUP00000017266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]