SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017325 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017325
Domain Number 1 Region: 683-944
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.43e-81
Family Eukaryotic proteases 0.00012
Further Details:      
 
Domain Number 2 Region: 348-452
Classification Level Classification E-value
Superfamily SRCR-like 7.06e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000552
Further Details:      
 
Domain Number 3 Region: 568-669
Classification Level Classification E-value
Superfamily SRCR-like 1.57e-39
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000735
Further Details:      
 
Domain Number 4 Region: 457-557
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 5 Region: 237-340
Classification Level Classification E-value
Superfamily SRCR-like 7.85e-31
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 6 Region: 169-240
Classification Level Classification E-value
Superfamily Kringle-like 1.21e-16
Family Kringle modules 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017325   Gene: ENSMPUG00000017435   Transcript: ENSMPUT00000017581
Sequence length 945
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896919.1:15819625:15895391:1 gene:ENSMPUG00000017435 transcript:ENSMPUT00000017581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRSRDAERKAQRAAGGEMGRGGRSARGGAGRDSSGGFEGRCSPAPAPSSPLLQNRRSRG
AWTKPGCSGTMTLACFVVALVLGALPEVIGFDLVVTYPLHHRYRHSPPASPRHPHYLPTQ
QRPQRTPPPPPVPRVPRPPPAMHAQRLHALHAGRTPGPHHRDCPAGEPWVNVTDFGAPCL
RWAEVPPFLERSPPASWAQLRGQRHNFCRSPDGAGRPWCFYGHAHGKVDWGYCDCRHGSV
RLRGGKHEFEGTVEIYANGTWGTVCGSHWDDADASVICHQLQLGRKGIAKQTPFSGLGLI
PIYWSNVRCRGDEENILLCEKDIWQGGACPQKMAAAVTCSFSQGPTFPAIRLVGGSSARE
GRVEVYHAGHWGTVCDDQWDEADAEVICRQLGLSGIAKAWNQAYFGEGSGPIMLDEVRCT
GNELSIEQCPKSSWGEHNCDHKEDAGVSCTPLTDGVIRLGGGKGSHEGRLEVYHRGRWGT
VCDDGWTELNTYVVCRQLGFKYGKQASANHFEESTGPIWLDDVSCSGKESSLVQCSRRQW
GRHDCSHREDVGITCYPGGNGYRLSLGFPIRLMDGENKKEGRVELFINGQWGTICDDGWT
DKDATVICRQLGYKGPAKARTMAYFGEGNGPIHVDNVKCTGNERSLADCIKQDIGRHNCR
HSEDAGVICDYFSKKATGNSNKESLSSVCGLRLVHHRQKRIIGGKNSLRGGWPWQVSLRL
KSSHGDGRLLCGATLLSSCWVLTAAHCFKRYGNSTRNYAVRVGDYHTLVPEEFEEEIGVQ
QIVIHRGYRPDSSDYDIALVRLEGPEEQCVRFSSHVLPACLPLRRERPQKTASNCYITGW
GDTGKAYSRTLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLQEHKRVDSCQGDSGGPLM
CVRSGESWVVYGVTSWGYGCGAKDSPGVYTKVSAFVPWIKSVTKL
Download sequence
Identical sequences M3Z163
ENSMPUP00000017325 ENSMPUP00000017325 XP_004748067.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]