SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017480 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017480
Domain Number 1 Region: 1049-1096
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 4.32e-17
Family Nuclear receptor coactivator interlocking domain 0.00012
Further Details:      
 
Domain Number 2 Region: 266-371
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.81e-16
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00097
Further Details:      
 
Domain Number 3 Region: 122-187
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000000000432
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.044
Further Details:      
 
Domain Number 4 Region: 35-92
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000072
Family HLH, helix-loop-helix DNA-binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017480   Gene: ENSMPUG00000017593   Transcript: ENSMPUT00000017739
Sequence length 1416
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:3887444:3955037:-1 gene:ENSMPUG00000017593 transcript:ENSMPUT00000017739 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLGESSLDPLAPDSRKRKLPCDTPGQGLTCSGEKWRREQESKYIEELAELISANLSDI
DNFNVKPDKCAILKETVRQIRQIKEQGKTISSDDDVQKADVSSTGQGVIDKDSLGPLLLQ
ALDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVN
GVAWTNETQRQKSHTFNCRMLMKTPHDILEDINTGPEMRQRYETMQCFALSQPRAMMEEG
EDLQSCMICVARRITTGERAFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRR
CIQRFFSLNDGQSWSQKRHYQEAYIHGHAETPVYRFSLADGTIVSAQTKSKLFRNPVTND
RHGFVSTHFLQREQNGYRQNTNPVGPGIRPPAAGCSSSVGSMSMSPNQGLQMLSNRTYGL
ADPSSIGPMSGARYGPSNPIASMNPGAGMQSPSSFQNSNYGLNMSSPPHGSPGLGSNQQN
IMISPRNRGSPKMASHQFSPVAGVHSPMGSSGNTGSHSFSSSSLSALQAISEGVGTSLLS
TLSSPGPKLDHSPNMNMSQPNKVNSQDSKSPLGLYCDQNPVESSMCQSNSRDHLSDKDSK
ESTVEGSENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKDSSINVTSPSGV
SSSTSGGVSSTSNMHGSLLQEKHRILHKLLQDGNSPADVAKITAEATGKDTSSTASCVEG
SVKQEQLSPKKKENNALLRYLLDRDDPSDTLSKELQPKVEGVDGKLSQCSSSAIPSSSQE
KDSKIKTETNEEGSGDLDNLDAILGDLTSSDFYNNSISTNGSNLGTKQQMFQGTNSLGLR
SPQSVQAIRPPYNRAVSLDSPVAVGSSPPVKNIGAFPMLPKQPMLGGNPRMMDSQENYGS
TMGGPNRNVTVNQTPSSGDWGLPNSKASRMEHMSANSMGRPGADYNASLPRPAVGGSMPT
LPLRANSIPGARPGLQQQQQQQQQQQQMLQMRPGEIPMGMGVSPYAQAAPSNQPGSWPDG
MLSMEQGPHGTQNRPLLRNSLDDLLGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEID
RALGIPELVNQGQALESKQDAFQGQEAAVMMDQKAALYGQTYPAQGPPVQGSFNLQGQSP
SFSSMMNPMNQQGNFPLQGMHPRANIMRPRTSTPKQLRMQLQQRLQGQQFLNQSRQALEM
KMDSPAAGSAAVMRPMMQPQVTSQQGFLNAQMVAQRSRELLSHHFRQQRVAVMMQQQQQQ
QQQQPQPQPQAFSPPPNVTASPSMDGVLAGPVMPQAPPQQFPYPPNYGMGQQPDPAFGRV
SSPPNAMMPSRMGPSQNPMMPHAQTAPLYQSSEIKGWPSGNLARNSSFPQQQFAHQGNPA
AYSMVHMNGSGGPMGQMNMNSMPMAGMPMGPDQKYC
Download sequence
Identical sequences M3Z1L8
ENSMPUP00000017480 ENSMPUP00000017480 XP_004746309.1.14098 XP_012908655.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]