SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017496 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017496
Domain Number 1 Region: 511-703
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.28e-54
Family Hemopexin-like domain 0.0000000396
Further Details:      
 
Domain Number 2 Region: 87-215,389-444
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 7.87e-32
Family Matrix metalloproteases, catalytic domain 0.00000114
Further Details:      
 
Domain Number 3 Region: 336-390
Classification Level Classification E-value
Superfamily Kringle-like 8.85e-22
Family Fibronectin type II module 0.00017
Further Details:      
 
Domain Number 4 Region: 275-331
Classification Level Classification E-value
Superfamily Kringle-like 7.99e-21
Family Fibronectin type II module 0.00014
Further Details:      
 
Domain Number 5 Region: 218-273
Classification Level Classification E-value
Superfamily Kringle-like 4e-20
Family Fibronectin type II module 0.00014
Further Details:      
 
Domain Number 6 Region: 31-104
Classification Level Classification E-value
Superfamily PGBD-like 9.89e-19
Family MMP N-terminal domain 0.0000856
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017496   Gene: ENSMPUG00000017609   Transcript: ENSMPUT00000017755
Sequence length 704
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:5278276:5286184:-1 gene:ENSMPUG00000017609 transcript:ENSMPUT00000017755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPSQPLVLVLLALGCCSAAPRPHHPTLVVFPGDWRANLTDKQLAQEYLFRYGYTLVGEM
NDKEESLGSALRLLQRRLSLPETGELDKTTLEAMRTPRCGVPDLGRFQTFEGNLKWHHQD
ITYWIQNYSEDLPRDVTDDAFARAFALWSAVTPLTFTRVYGPEADIVIQFGVREHGDGYP
FDGKDGLLAHAFPPGQGIQGDAHFDDEELWSLGKGVVVPTYFGNSDGAPCHFPFTFEGRS
YSACTTDGRSDNVAWCSTTADYDTDRRFGFCPSERLFTQDGNGEGKPCVFPFTFEGKSYS
TCTTDGRSDGYRWCATTANYDQDKLYGFCPTRVDSRATGGNSAGEPCVFPFIFLGKEYST
CTREGRGDGHLWCATTSNFDRDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYSFTEGPPLHEDDVKGIQYLYGSRQDPEPGPPTVQPTAPPTVCPTGPPTTRPSERPTT
GPTGPPAAGPTGPPTAGPSETTTVTFHPAEDICKVNFFDAIAEIRNRLHLFKDGKYWQFS
KGKGRPVQGPFLITDSWPALPRKLDSVFEDPLTKKIFFFSGRQVWVYTGSSVLGPRRLDK
LGLGPEVAQVIGALPQGGGKVLLFSGRSFWSFDVKAQRVDPKSLGSVEQEFPGVPLNSHN
VFQYQGKAHFCQDRFYWRVNSRHEANQVDEVGYVTFDFLQCPED
Download sequence
Identical sequences M3Z1N4
ENSMPUP00000017496 XP_004746360.1.14098 ENSMPUP00000017496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]