SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017835 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017835
Domain Number 1 Region: 2-107
Classification Level Classification E-value
Superfamily FKBP-like 1.69e-42
Family FKBP immunophilin/proline isomerase 0.00000117
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017835   Gene: ENSMPUG00000017946   Transcript: ENSMPUT00000018096
Sequence length 108
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896916.1:18818486:18836935:-1 gene:ENSMPUG00000017946 transcript:ENSMPUT00000018096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLVFDVELLKLE
Download sequence
Identical sequences A0A2I2UG00 L5K0M6 M3Z2M3
ENSSARP00000006075 ENSMPUP00000017835 ENSMPUP00000017835 ENSFCAP00000018930 ENSSARP00000006075 NP_001239119.1.84170 XP_003411674.1.64505 XP_004370553.1.4749 XP_004393048.1.74151 XP_004433901.1.5094 XP_004746817.1.14098 XP_006092758.1.53796 XP_006727565.1.47382 XP_006881458.1.29581 XP_006881459.1.29581 XP_006921735.1.64745 XP_006929983.1.62641 XP_007932691.1.48129 XP_011382829.1.92234 XP_019314487.1.44245 XP_019501337.1.44202 XP_019610751.1.88060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]