SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017860 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017860
Domain Number 1 Region: 325-381
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000000000196
Family VPS37 C-terminal domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 62-130
Classification Level Classification E-value
Superfamily UBC-like 0.00000000184
Family UBC-related 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017860   Gene: ENSMPUG00000017971   Transcript: ENSMPUT00000018121
Sequence length 397
Comment pep:known scaffold:MusPutFur1.0:GL897143.1:1391671:1441702:-1 gene:ENSMPUG00000017971 transcript:ENSMPUT00000018121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWLFPLTKSASSSAAGSPGGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTVNN
LTININILLPPQFPQEKPVISVYPPIRHHLMDKQGVYVTSPLVNNFTMHSDLGKIIQSLL
DEFWKNPPVLAPSSTAFPYLYSNPGGMPPYASQGFPFLHPYPPQEANRTITSLSVADTIS
SSTTSYTPAKPAAPSFGVLSNLPLPVPTTDTSAPVSQDGFGYKMPDIPDTFPELSELSVS
QLTDMNDQEEILLEQFLTLPQLKQIINDKDDLVKSIEELARKNLLLEPSLEAKRQTVLDK
YELLTQLKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKTEID
DFLSSFMEKRTICHCRRAKEEKLQQAIAMHSQFHTPL
Download sequence
Identical sequences G9KXE9
ENSMPUP00000017860 ENSMPUP00000017860 XP_004777510.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]