SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017922 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000017922
Domain Number - Region: 64-126
Classification Level Classification E-value
Superfamily ABC transporter transmembrane region 0.0902
Family ABC transporter transmembrane region 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017922   Gene: ENSMPUG00000018033   Transcript: ENSMPUT00000018183
Sequence length 143
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897084.1:570805:649121:-1 gene:ENSMPUG00000018033 transcript:ENSMPUT00000018183 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESETEIIDLQPGNPNPRRSQPINLNHYATKKSMAESMLDVALFMSNTTRLKAVLEQGPA
SHYYTALVTLISVSLLLQVAIGILLVVIARWNLNEVGKQGQVNQLNNTATSLVAITVVIN
VFITAFGVHKTGSLAARTSRNPL
Download sequence
Identical sequences M3Z2W0
ENSMPUP00000017922 ENSMPUP00000017922 XP_004773776.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]