SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018057 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000018057
Domain Number - Region: 14-112
Classification Level Classification E-value
Superfamily DNA clamp 0.00439
Family DNA polymerase processivity factor 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018057   Gene: ENSMPUG00000018169   Transcript: ENSMPUT00000018321
Sequence length 280
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896901.1:12135928:12148229:1 gene:ENSMPUG00000018169 transcript:ENSMPUT00000018321 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFRAKIVDAACLNHFTRVSAMVAKLAKICALRISPQTMNFILSDKVAGGGVSMWCELEQ
ENFFSEFQMEGVSAENNAIYLELTSENLSRALKTAQNARALKVKLTNKHFPCLTVSIELL
SVSSSSRIVTHDIPVKVIPRKLWKDLQEPTVPDSDVSIYLPVLKTMKSIVEKMRNLSNHL
IIEANLSGDLNLKIETELVCVTTHFKDLGNPPLASEDASQDRDPEQMAEVRIDIRKLLQF
LAGQQVNPTRAVCNIVSNKLVHFDLLHEDVSLQYFIPAFS
Download sequence
Identical sequences M3Z395
ENSMPUP00000018057 XP_004739479.1.14098 ENSMPUP00000018057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]