SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018138 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018138
Domain Number 1 Region: 247-543
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 9.03e-42
Family NadC C-terminal domain-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018138   Gene: ENSMPUG00000018252   Transcript: ENSMPUT00000018404
Sequence length 551
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896901.1:18286823:18325369:1 gene:ENSMPUG00000018252 transcript:ENSMPUT00000018404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQPPPSRADCFLRKKSQNIKGSKSSATQAEEIGVDAEQRVPSDLPHRRSSDFKERLRRTY
WDKRAAGKRFDPQSQPETKVTHYKQYPPNTSKVYSYFECREKKTENSKIKKVKYEETVFY
GLQYILNKYLKGKVVTKEKIQEAKEVYREHFQDDVFNEKGWNYILEKYDGHLPIEIKAVP
EGYVIPRGNVLFTVENTDPECYWLTNWIETILVQSWYPITVATNSREQKKILAKYLLETS
GNLNGLEYKLHDFGYRGVSSQETAGIGASAHLVNFKGTDTVAGIAFVKKYYGTKDPVPGY
SVPAAEHSTITAWGKDREKDAFEHIVTQFSSVPVSVVSDSYDIYNACEKIWGEDLRHLIL
SRSTEAPLIIRPDSGNPLDTVLKVLDILGKKFPVTENAKGYKLLPPYLRIIQGDGVDINT
LQEIVEGMKQKKWSIENIAFGSGGALLQKLTRDLLNCSFKCSYVVTNGLGINVFKDPVAD
PNKRSKKGRLSLHRTPAGNFVTLEEGKGDLEEYGHDLLHTVFKNGKVTKSYSFDEIRKNA
ELNIELEVAPH
Download sequence
Identical sequences M3Z3H6
ENSMPUP00000018138 ENSMPUP00000018138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]