SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018177 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018177
Domain Number 1 Region: 490-717
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.48e-59
Family Eukaryotic proteases 0.00000000517
Further Details:      
 
Domain Number 2 Region: 205-288
Classification Level Classification E-value
Superfamily Kringle-like 1.55e-33
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 3 Region: 115-204
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-32
Family Kringle modules 0.0000137
Further Details:      
 
Domain Number 4 Region: 297-380
Classification Level Classification E-value
Superfamily Kringle-like 6.77e-32
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 5 Region: 376-472
Classification Level Classification E-value
Superfamily Kringle-like 2.03e-28
Family Kringle modules 0.0004
Further Details:      
 
Domain Number 6 Region: 36-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 9.02e-22
Family Hairpin loop containing domain 0.00000533
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018177   Gene: ENSMPUG00000018295   Transcript: ENSMPUT00000018447
Sequence length 725
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896901.1:25782759:25866088:-1 gene:ENSMPUG00000018295 transcript:ENSMPUT00000018447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWGTKLLPVLLLQHVLLHLLLLPIAIPYAEGQKKRRNTLHEFKKSAKTTLIKEDPLLKIK
TKKMNTADQCANRCIRNKGLPFTCKAFVFDKARKRCLWLPFNSMTSGVKKEFGHEFDLYE
NKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSYRGKDLQENYCRNPRGEEG
GPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQTPHRHKF
LPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHGTMNDTDVPMETTEC
IQGQGEGYRGTISTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGAESPWC
FTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWEKNMEDLHRH
IFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVI
SCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWILTARQCFPSRNKDLKD
YEAWLGIHDVHGKGDEKRKQVLNVSQLVYGPEGSDLVLLKLARPAVLDDFVSTIDLPNYG
CTIPEKTTCSVYGWGYTGSINFDGLLRVAHLYIMGNEKCSQYHQGKVTLNESEICAGAEN
IASGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTY
KIPQS
Download sequence
Identical sequences M3Z3L5
ENSMPUP00000018177 ENSMPUP00000018177 XP_004739678.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]