SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018181 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018181
Domain Number 1 Region: 31-522
Classification Level Classification E-value
Superfamily Sema domain 4.45e-173
Family Sema domain 0.0000000000557
Further Details:      
 
Domain Number 2 Region: 518-572
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000209
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 591-672
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000161
Family I set domains 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018181   Gene: ENSMPUG00000018299   Transcript: ENSMPUT00000018451
Sequence length 775
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896901.1:27412191:27668653:-1 gene:ENSMPUG00000018299 transcript:ENSMPUT00000018451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASAANLVTWLLWGYLQELWIGGHTADSPHPRLRLSHKELLDLNRTSIFHSPFGFLDLHA
MLLDEYQERLFVGGKDLVYSLSLEQISNGYQEIHWPSTALKIEECIMKGKDASECANYVR
VLHHYNRTHLLTCGTGAFDPLCAFIRVGYHLEDPLFHLEPHRSERGRGRCPFDPSSSFIS
TLVGSELFTGLYSDYWGRDAAVFRSMGRLAHIRTEHDDERLLKEPKFVGSYLIPDNEDRD
DNKVYFFFTEKALEAESNAHAIYARVGRLCVNDVGGQRILVNKFSTILKARLVCSVPGMN
GIDTYFDELEDIFLLHTRDHKNPVIFGLFNTTSNIFRGHAICVYHMSSIRAAFNGPYAHK
EGPEYHWSLYEGRVPYPRPGSCASKVNGGRYGTTKDYPDDAIRFARSHPLMYQSIKPAHK
KPILVKTDGRYNLKQIAVDRVEAEDGQYDVLFIGTDNGIVLKVITIYNQETESMEEVILE
ELQIFKDPVPIISMEISSKRQQLYIGSASAVAQVRFHQCDMYGSACADCCLARDPYCAWD
GISCSRYYPTGTHAKRRFRRQDVRHGNAAQQCFGQQFIGDALDKTEERLAYGIENNSTLL
ECTPRSLQAKVIWFVQKGRDGRKEEVKTDDRVVKMDLGLLFLRVRKMDAGTYFCQTVEHG
FVHTVRKITLEVVDEERVEEMFHKDYEEDGPHKMPCPVQTSLPHGAKPWYKEFLQLIGYS
NFQRVEEYCEKVWCTDKKRKKLKMSPSKWKYANPQEKKLRPKAEHYRLPRHTLDS
Download sequence
Identical sequences M3Z3L9
ENSMPUP00000018181 XP_004739686.1.14098 ENSMPUP00000018181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]