SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018182 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018182
Domain Number 1 Region: 28-520
Classification Level Classification E-value
Superfamily Sema domain 1.06e-193
Family Sema domain 0.00000000000000363
Further Details:      
 
Domain Number 2 Region: 516-567
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000855
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 585-668
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000124
Family V set domains (antibody variable domain-like) 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018182   Gene: ENSMPUG00000018300   Transcript: ENSMPUT00000018452
Sequence length 772
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896901.1:27966615:28174337:-1 gene:ENSMPUG00000018300 transcript:ENSMPUT00000018452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWFARIVSLFWGVLLTARANYQNGKNNVPRLKLSYKEMLESNNVITFNGLANSSSYHTF
LLDEERSRLYVGAKDHIFSFNLVNIKDFQKIVWPVSYTRRDECKWAGKDILKECANFIKV
LKAYNQTHLYACGTGAFHPICTYIEIGHHPEDNIFKLEDSHFENGRGKSPYDPKLLTASL
LIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNDPRFISAHLIPESDNPED
DKVYFFFRENAIDGEHTGKATHARIGQICKNDFGGHRSLVNKWTTFLKARLICSVPGPNG
IDTHFDELQDVFLMNSKDPKNPIVYGVFTTSSNIFKGSAVCMYSMSDVRRVFLGPYAHRD
GPNYQWVPFQGRVPYPRPGTCPSKTFGGFDSTKDLPDDVITFARSHPAMYNPVFPINNRP
IMIKTDVNYQFTQIVVDRVDAEDGQYDVMFIGTDVGTVLKVVSIPKETWHDLEEVLLEEM
TVFREPTTISAMELSTKQQQLYIGSTTGVAQLPLHRCDIYGKACAECCLARDPYCAWDGS
SCSRYFPTAKRRTRRQDIRNGDPLTHCSDLQHHGNHHGHSLEERIIYGVENSSTFLECSP
KSQRALVYWQFQRRNEERKEEIRVDDHIIRTEQGLLLRSLQRKDSGNYLCHAVEHGFMQT
LLKVTLEVIDTEHLEELLHKDDDGDGSKTKEISNSMTPSQKVWYRDFMQLINHPNLNTMD
EFCEQVWKRDRKQRRQRPGHNQGNSNKWKHLQENKKGRNRRTHEFERAPRSV
Download sequence
Identical sequences M3Z3M0
ENSMPUP00000018182 ENSMPUP00000018182 XP_004739687.1.14098 XP_004739688.1.14098 XP_004739689.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]