SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018183 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018183
Domain Number 1 Region: 41-537
Classification Level Classification E-value
Superfamily Sema domain 1.44e-185
Family Sema domain 0.0000000000141
Further Details:      
 
Domain Number 2 Region: 533-585
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000209
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 3 Region: 601-683
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000409
Family I set domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018183   Gene: ENSMPUG00000018301   Transcript: ENSMPUT00000018453
Sequence length 777
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896901.1:28821790:29005871:-1 gene:ENSMPUG00000018301 transcript:ENSMPUT00000018453 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTANKNERPKFRSHDFHLFHALMILSMTMLFLPVIGTSKQNIPRLKLTYKDLLLSNSCIP
FLGSSEGLDFQTILLDEERGRLLVGAKDHIFLLSLIDLNKNFKKIYWPAAKERVELCKLA
GKDANTECANFIRVLQPYNKTHLYVCGTGAFHPICGYIDLGVYKEEVIFKLDTQNLESGR
LKCPFDPQQPFASVMTDEYLYSGTASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNG
AKFIGTFPIPDTYNPDDDKIYFFFRESSQEGTTSDKTILSRVGRVCKNDVGGQRSLINKW
TTFLKARLVCSIPGNDGADTHFDELQDIYLLPTRDERNPVVYGVFTTTSSIFKGSAVCVY
SMADIRAVFNGPYAHKESADHRWVQYDGRIPYPRPGTCPSKTYDPLIKSTRDFPDDVISF
IKRHPVMFKSVYPVAGGPTFKRINVDYRLTQIVVDHVVAEDGQYDVMFLGTDIGTVLKVV
SISKEKWNMEEVVLEELQVFKHSSIILNMELSLKQQQLYIGSRDGLVQLSLHRCDTYGKA
CADCCLARDPYCAWDGNACSRYAPTSKRRARRQDVKYGDPITQCWDVEDSISHETADEKV
IFGIEFNSTFLECIPKSQQASIKWYVQRSGDEHREELKPDERIIKTEYGLLIRSLQKKDS
GMYYCRAQEHTFIHTIVKLTLNVIENEQMENTQRAEHEEGQVKDLLAESRLRYKDYIQIL
SSPNFSLDQLCEQMWHREKRRQRNKGGPKWKHVQEMKKKRNRRHHRDLDGLPRAVDT
Download sequence
Identical sequences M3Z3M1
ENSMPUP00000018183 XP_004739691.1.14098 XP_012916243.1.14098 XP_012916247.1.14098 XP_012916254.1.14098 ENSMPUP00000018183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]