SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018418 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018418
Domain Number 1 Region: 31-512
Classification Level Classification E-value
Superfamily ALDH-like 3.01e-186
Family ALDH-like 0.00000000000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018418   Gene: ENSMPUG00000018536   Transcript: ENSMPUT00000018688
Sequence length 517
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896918.1:3826127:3827680:1 gene:ENSMPUG00000018536 transcript:ENSMPUT00000018688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRPLVPRLLCLRVRTAPYSSAAALPSPIPNPDIRYNQLFINNEWQDAASKKTFPTVNPA
TGEVIGHVAEGDRADVDRAVKAAREAFRLGSPWRRMDASERGRLLNRLADLVERDRVYLA
SLETLDNGKPFQESYALDLDEVIKVYRYFAGWADKWHGKTIPMDGEHFCFTRHEPVGVCG
QIIPWNFPLVMQGWKLAPALATGNTVVMKVAEQTPLSALYLASLIKEAGFPPGVVNIVTG
YGPTAGAAIAQHMDVDKVAFTGSTEVGHLIQKAAGDSNLKRVTLELGGKSPSIVLADADM
DHAVEQCHEALFFNMGQCCCAGSRTFVEESIYDEFLERTVEKAKQRRVGNPFELDTQQGP
QVDKEQFERILSYIRLGQKEGAQLLCGGERFGERGFFIKPTVFGGVQDDMRIAREEIFGP
VQPLFKFRKMEEVIERANNTRYGLAAAVFTRDLDKAMYFTQALQAGTVWVNTYNIVTCHT
PFGGFKESGNGRELGEDGLKAYTEVKTVTIKIPQKNS
Download sequence
Identical sequences M3Z4A6
ENSMPUP00000018418 ENSMPUP00000018418 XP_004747712.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]