SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018462 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018462
Domain Number 1 Region: 5-358
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 6.07e-53
Family Extradiol dioxygenases 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018462   Gene: ENSMPUG00000018580   Transcript: ENSMPUT00000018732
Sequence length 371
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896903.1:4173544:4174659:-1 gene:ENSMPUG00000018580 transcript:ENSMPUT00000018732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVHARRLCHIAFHVPAGQPLTQDLQRLFGFQPLAVREAEGWRQLALRSGDAVFLVNEGA
GLGEPLYGLDPRHAVPSATNLCFDVADAGAAARALVAQGCSVPVPPVSVRDTQGTATYAV
VRSPAGNLSLTLLERAGVRGPFLPGFQPVSSAASPSWVSHVDHLTLACIPGSSPTLMRWF
HDCLDFHHLPLSPDEDPETGLEVTAGSGRGGLKLTALQTPPGSAVPTLVLAETLPGASSG
QDQVEQFLTRHRGPGLQHVGLYTPNIVEATERVAAAGGQLLAPPEAYYEQPGKERQILAA
GHEPSLLARQGILLDGDEGKFLLQVFTKSLFPEDTFFLELIQRQGATGFGQGNIRALWQS
VQEQATREWEA
Download sequence
Identical sequences M3Z4F0
ENSMPUP00000018462 XP_004740492.1.14098 ENSMPUP00000018462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]