SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000019983 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000019983
Domain Number - Region: 47-81
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0118
Family RILP dimerisation region 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000019983   Gene: ENSMPUG00000020117   Transcript: ENSMPUT00000020269
Sequence length 186
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL897356.1:104763:105320:1 gene:ENSMPUG00000020117 transcript:ENSMPUT00000020269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YDSLYQELDLDSLHEDLSHSMPGTMTVTSANTHESHLTAEPEDLREAERKELKSELTKVE
EEIITLRHALAAKERCCMELKRKLGLIALVGLRQNLSKGWHDVQVSSVYMKQKTSAALST
MGSAIYGKLGDMKKSSTFRSFEGLMGAIKSRVAGDRKFSSNCLPSSTGGGNDLLLASGSR
DDPLPL
Download sequence
Identical sequences M3Z8R9
ENSMPUP00000019983 ENSMPUP00000019983

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]