SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000003855 from Mustela putorius furo 76_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000003855
Domain Number 1 Region: 196-443
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.12e-87
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 100-203
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-16
Family Hepsin, N-terminal domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000003855   Gene: ENSMPUG00000003885   Transcript: ENSMPUT00000003924
Sequence length 478
Comment pep:known_by_projection scaffold:MusPutFur1.0:GL896924.1:3125738:3141088:-1 gene:ENSMPUG00000003885 transcript:ENSMPUT00000003924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEPRAEEGWQAGARCTDAALPSPAASLAGCRGAGQRCCAGLGALVLLAGVSVGSWLLVL
YLRPATSQPTPGTLQDEEIPSSCSETSGAEALFPTLSRTVSFRINSEDFLLEAQVRARPD
WLLVCHEGWNPALGVRICQSLGHLRLTHLKGVNLSDIKLNSSQRFAQLPPRLEGFLEEVW
QSRNSCASGQIVSLRCSACGARPLASRIVGGQAVAPGRWPWQASVALGSRHTCGASVVAP
HWVVTAAHCVHSSRVPRLSSWRVHVGLVSHSAVRPHQGAVVERIVPHPLYSSQTHDYDIA
LLRLWTPLNFSDTVGAVCLPAKKQDFPRGSQCWVSGWGHTNPSHTHNSDTLQDTLVPLLS
TELCNSSCMYSGALTPRMLCAGYVDGRADACQGDSGGPLVCLDRGTWHLVGVVSWGRGCA
EPNHPGVYAKVAEFLDWIHDIVRFPQVSLISAPQSRYEAQRAPLGEAKRGAVVPLGGR
Download sequence
Identical sequences M3XXQ4
ENSMPUP00000003855 ENSMPUP00000003855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]